BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C11 (395 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 1.8 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 24 2.3 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 23 3.1 DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. 22 9.4 CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 22 9.4 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.2 bits (50), Expect = 1.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 Query: 290 GHIPSNKFAFLMKEIPSPNCT*CEVI 367 G I + M +PSP+C+ C I Sbjct: 966 GKISHGELLHRMNRVPSPSCSFCSAI 991 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.8 bits (49), Expect = 2.3 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 75 DGIPRKEIPLFTDHVMLVKEQCKDAWQ 155 DG + PLF++ LVKE + AW+ Sbjct: 98 DGTQHESHPLFSEMEELVKEGDEMAWK 124 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 23.4 bits (48), Expect = 3.1 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 236 RRHKV*QNYSKHSPKTLFGHIPSNKFAFLMKEI 334 R++ V NY + + +IP+N F +KE+ Sbjct: 487 RKYDVGWNYGELKYRATLVNIPANDLKFQLKEV 519 >DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. Length = 508 Score = 21.8 bits (44), Expect = 9.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 327 FIKNANLFDGMWPNK 283 F+ NA F+G W NK Sbjct: 280 FLMNALYFNGTWLNK 294 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 21.8 bits (44), Expect = 9.4 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = -2 Query: 130 LTNMTWSVNNGISFLGMPSCI*YLH 56 L+N+ W++N+ G+ C+ Y+H Sbjct: 426 LSNLGWNLNSLQFPSGIHICVTYMH 450 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 432,601 Number of Sequences: 2352 Number of extensions: 7862 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31212099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -