BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C08 (262 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 21 5.6 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 21 9.7 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 21.4 bits (43), Expect = 5.6 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = -1 Query: 229 HFLCFAHRFASAIPISARFVHLATNVDTKNQHLWKSMFNLSKFC 98 H CF H P S V L +N + L ++ L+K+C Sbjct: 748 HADCFNHCLEVYRPSSGGAVALQSNGTCASLWLGNAIQTLNKYC 791 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 20.6 bits (41), Expect = 9.7 Identities = 6/16 (37%), Positives = 9/16 (56%) Frame = -2 Query: 51 HHVHVSDQNPEIKHPS 4 H HV +P + HP+ Sbjct: 127 HLPHVQQHHPSVHHPA 142 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 246,674 Number of Sequences: 2352 Number of extensions: 3673 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 563,979 effective HSP length: 54 effective length of database: 436,971 effective search space used: 13983072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -