BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C08 (262 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49937-6|CAA90185.2| 453|Caenorhabditis elegans Hypothetical pr... 25 7.4 Z81502-4|CAB04107.2| 357|Caenorhabditis elegans Hypothetical pr... 25 9.8 >Z49937-6|CAA90185.2| 453|Caenorhabditis elegans Hypothetical protein F14F3.3 protein. Length = 453 Score = 25.0 bits (52), Expect = 7.4 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = -2 Query: 147 LRINTYGNQCSIYQSFVIIFTEIL*FTFKTSIHHVHVSDQNP 22 L +N + ++ Q +II I+ TF+ + VH SD+NP Sbjct: 99 LPVNEVASHTNVIQ--LIITLRIIGITFEENDAWVHKSDENP 138 >Z81502-4|CAB04107.2| 357|Caenorhabditis elegans Hypothetical protein F14B6.4 protein. Length = 357 Score = 24.6 bits (51), Expect = 9.8 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -1 Query: 169 HLATNVDTKNQHLWKSMFNLSKFCYYFYR 83 H T+ DT+ W + N +F YFYR Sbjct: 308 HSLTDEDTRGVLAWHTGKNDQQFLDYFYR 336 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,674,037 Number of Sequences: 27780 Number of extensions: 86826 Number of successful extensions: 203 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 203 length of database: 12,740,198 effective HSP length: 65 effective length of database: 10,934,498 effective search space used: 229624458 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -