BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C06 (445 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0P6N7 Cluster: Plasma memebrane H+-ATPase; n=1; Planta... 34 1.6 UniRef50_Q8JTZ7 Cluster: CD47-like protein; n=5; Capripoxvirus|R... 32 6.4 >UniRef50_Q0P6N7 Cluster: Plasma memebrane H+-ATPase; n=1; Plantago major|Rep: Plasma memebrane H+-ATPase - Plantago major (Common plantain) Length = 106 Score = 33.9 bits (74), Expect = 1.6 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +2 Query: 2 DPPGCRNSARGPFGIV 49 DPPGCRNSARGP GI+ Sbjct: 15 DPPGCRNSARGP-GII 29 >UniRef50_Q8JTZ7 Cluster: CD47-like protein; n=5; Capripoxvirus|Rep: CD47-like protein - Lumpy skin disease virus NW-LW Length = 301 Score = 31.9 bits (69), Expect = 6.4 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = -2 Query: 297 KRGVLFQSFTYKFDMNFLISKTLTDTINYRQTNVIIHYDICI*YKVLYNHNLS*N 133 K ++F T + +F IS+ +INY + N I D I + V YN N++ N Sbjct: 8 KVNIIFLFLTIYINSSFSISENKVSSINYSKCNKTIVIDCNINHFVKYNENVTIN 62 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 330,301,602 Number of Sequences: 1657284 Number of extensions: 5100326 Number of successful extensions: 9374 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9370 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 22761518346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -