BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C06 (445 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83233-5|CAB05765.2| 340|Caenorhabditis elegans Hypothetical pr... 29 1.5 AL023835-15|CAA19492.2| 520|Caenorhabditis elegans Hypothetical... 28 3.5 >Z83233-5|CAB05765.2| 340|Caenorhabditis elegans Hypothetical protein K06B4.5 protein. Length = 340 Score = 29.1 bits (62), Expect = 1.5 Identities = 19/57 (33%), Positives = 30/57 (52%) Frame = +2 Query: 107 TNTQTRGTMFYDKL*LYNTLYYIHIS**IITFVCL*FIVSVKVFEIKKFISNLYVND 277 TN++T T F + L ++NT IH + + F C+ V F+ KK + +Y ND Sbjct: 273 TNSRTAPTRFTELLSVFNT---IHKTVNNMRFSCMMVQCFVPNFKFKKLMREVYFND 326 >AL023835-15|CAA19492.2| 520|Caenorhabditis elegans Hypothetical protein Y37A1B.9 protein. Length = 520 Score = 27.9 bits (59), Expect = 3.5 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -2 Query: 255 MNFLISKTLTDTINYRQTNVIIHYDICI*YKVLYNHNLS 139 + +ISKT D + Y ++ + C+ Y++ Y NL+ Sbjct: 428 LEHVISKTSDDVVMYENPSMYSNNQECLLYRITYQTNLN 466 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,709,416 Number of Sequences: 27780 Number of extensions: 127946 Number of successful extensions: 195 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 195 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 767282256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -