BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C05 (406 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24731| Best HMM Match : DUF1534 (HMM E-Value=8.8) 30 0.82 SB_17282| Best HMM Match : LRR_1 (HMM E-Value=1.1e-07) 27 7.7 >SB_24731| Best HMM Match : DUF1534 (HMM E-Value=8.8) Length = 128 Score = 29.9 bits (64), Expect = 0.82 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = +1 Query: 1 CCRNRHEASFYKRISFQRTACLVDCLELH*HFLLEVYYFLK*ICVYFLQSLNVSIL 168 CC R ++ FY R+ Q L D + YYF I ++FL+S V IL Sbjct: 21 CCDER-DSRFYYRLVLQTKRFLKDFSPFDSAYFRIKYYFQAAIFLHFLKSAKVQIL 75 >SB_17282| Best HMM Match : LRR_1 (HMM E-Value=1.1e-07) Length = 651 Score = 26.6 bits (56), Expect = 7.7 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = +1 Query: 151 LNVSILTLTF*FK--KNYIRELSDDQIKINIFNSKHYNIFTILKLNQSECYISCDLLI 318 LN ++ L F FK K+Y+ + S+ + KI ++ N+F++ + C+I C L+ Sbjct: 137 LNRTVEILGFSFKQVKDYVTKFSESRPKIWEHIQQNANLFSLCYI-PVNCFIICHCLL 193 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,195,022 Number of Sequences: 59808 Number of extensions: 159219 Number of successful extensions: 202 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 200 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 202 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 727815563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -