BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C05 (406 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 1.7 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 22 3.0 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 1.7 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -1 Query: 385 QRALWSMKIPPLSTVRHYKIKTKLINHTICSI 290 Q +W MK S + HY + + NH I ++ Sbjct: 1019 QWKIWPMKGEEKSRLFHYSVVPFVSNHDILNL 1050 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.8 bits (44), Expect = 3.0 Identities = 8/35 (22%), Positives = 17/35 (48%) Frame = +1 Query: 7 RNRHEASFYKRISFQRTACLVDCLELH*HFLLEVY 111 R RH ++ R AC + + ++L+++Y Sbjct: 194 RQRHSTIHLSTGNYSRLACEIQFVRSMGYYLIQIY 228 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,675 Number of Sequences: 438 Number of extensions: 1630 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10132494 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -