BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C03 (402 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21296| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-10 SB_27133| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 3e-10 SB_27134| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 7e-10 SB_7534| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 7e-10 SB_29575| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_58496| Best HMM Match : Ferritin (HMM E-Value=0.0012) 50 7e-07 SB_18389| Best HMM Match : Ferritin (HMM E-Value=2.8e-26) 40 0.001 SB_7503| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_23051| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_56909| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_30861| Best HMM Match : Peptidase_A17 (HMM E-Value=2.1e-40) 29 1.4 SB_16785| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_44028| Best HMM Match : RVT_1 (HMM E-Value=1.3) 29 1.4 SB_25615| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-10) 29 1.4 SB_5393| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 29 1.4 SB_616| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_23890| Best HMM Match : Oxidored_q4 (HMM E-Value=1) 29 1.9 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_45259| Best HMM Match : CH (HMM E-Value=0.00071) 28 3.3 SB_26997| Best HMM Match : WD40 (HMM E-Value=1.3e-08) 28 3.3 SB_43840| Best HMM Match : NDK (HMM E-Value=0) 28 3.3 SB_31035| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.3 SB_57416| Best HMM Match : rve (HMM E-Value=0.0011) 27 4.3 SB_40777| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_28841| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_35800| Best HMM Match : 7tm_1 (HMM E-Value=3e-05) 27 4.3 SB_46811| Best HMM Match : Ferritin (HMM E-Value=0.0021) 27 5.7 SB_58376| Best HMM Match : M20_dimer (HMM E-Value=0.00027) 27 5.7 SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_6592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_3591| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_21441| Best HMM Match : zf-A20 (HMM E-Value=2.2) 26 10.0 SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 10.0 SB_1830| Best HMM Match : DUF331 (HMM E-Value=3.5) 26 10.0 SB_57677| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 10.0 SB_3090| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 10.0 >SB_21296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 62.5 bits (145), Expect = 1e-10 Identities = 30/65 (46%), Positives = 39/65 (60%) Frame = +3 Query: 156 HNPCKDSMHAQIQTEVDASVQYLAMGAHFSRDVINRPGFAKLFFDAASEEREHAMKLIDY 335 H C+ ++ QI E+ AS YL+M HF RD + PGF K F A+ EEREHA KL+ + Sbjct: 196 HEECEAGINKQINLELYASYAYLSMAFHFDRDDVALPGFHKYFLKASHEEREHAEKLMKF 255 Query: 336 LLMRG 350 RG Sbjct: 256 QNERG 260 Score = 41.9 bits (94), Expect = 2e-04 Identities = 20/39 (51%), Positives = 24/39 (61%) Frame = +3 Query: 234 AHFSRDVINRPGFAKLFFDAASEEREHAMKLIDYLLMRG 350 AHF RD I+ PGFA F AA EE HA +++L RG Sbjct: 2 AHFGRDDIHLPGFAAFFKKAAEEEYTHAHMFMEFLNKRG 40 >SB_27133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 61.3 bits (142), Expect = 3e-10 Identities = 29/65 (44%), Positives = 39/65 (60%) Frame = +3 Query: 156 HNPCKDSMHAQIQTEVDASVQYLAMGAHFSRDVINRPGFAKLFFDAASEEREHAMKLIDY 335 H + ++ QI E+ AS Y++M HF RD + PGF K F +A+ EEREHA KL + Sbjct: 143 HEESEAGVNKQINLELYASYVYMSMAFHFDRDDVALPGFHKYFMEASHEEREHAEKLAKF 202 Query: 336 LLMRG 350 L RG Sbjct: 203 QLQRG 207 >SB_27134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 289 Score = 60.1 bits (139), Expect = 7e-10 Identities = 29/65 (44%), Positives = 38/65 (58%) Frame = +3 Query: 156 HNPCKDSMHAQIQTEVDASVQYLAMGAHFSRDVINRPGFAKLFFDAASEEREHAMKLIDY 335 H + ++ QI E+ AS Y++M HF RD + PGF K F A+ EEREHA KL + Sbjct: 128 HEESEAGVNKQINLELYASYVYMSMAYHFDRDDVALPGFHKYFMKASHEEREHAEKLAKF 187 Query: 336 LLMRG 350 L RG Sbjct: 188 QLQRG 192 >SB_7534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 60.1 bits (139), Expect = 7e-10 Identities = 29/65 (44%), Positives = 38/65 (58%) Frame = +3 Query: 156 HNPCKDSMHAQIQTEVDASVQYLAMGAHFSRDVINRPGFAKLFFDAASEEREHAMKLIDY 335 H + ++ QI E+ AS Y++M HF RD + PGF K F A+ EEREHA KL + Sbjct: 11 HEESEAGVNKQINLELYASYVYMSMAFHFDRDDVALPGFHKYFIKASHEEREHAEKLAKF 70 Query: 336 LLMRG 350 L RG Sbjct: 71 QLQRG 75 >SB_29575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 52.0 bits (119), Expect = 2e-07 Identities = 24/56 (42%), Positives = 33/56 (58%) Frame = +3 Query: 156 HNPCKDSMHAQIQTEVDASVQYLAMGAHFSRDVINRPGFAKLFFDAASEEREHAMK 323 H C+ ++ QI E+ AS Y +M +F R+ ++ PGF K F A EEREHA K Sbjct: 9 HEECEAGINKQINLELYASYVYTSMACYFDREDVHLPGFHKFFKKQAHEEREHAEK 64 >SB_58496| Best HMM Match : Ferritin (HMM E-Value=0.0012) Length = 126 Score = 50.0 bits (114), Expect = 7e-07 Identities = 25/53 (47%), Positives = 31/53 (58%) Frame = +3 Query: 159 NPCKDSMHAQIQTEVDASVQYLAMGAHFSRDVINRPGFAKLFFDAASEEREHA 317 N + ++ QI E+ A YL+M HF RD IN PGF K F A+ EE EHA Sbjct: 32 NQLEGPINKQINKELYAHYTYLSMAFHFDRDDINLPGFNKFFKKASKEEWEHA 84 >SB_18389| Best HMM Match : Ferritin (HMM E-Value=2.8e-26) Length = 175 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/67 (31%), Positives = 34/67 (50%) Frame = +3 Query: 150 TMHNPCKDSMHAQIQTEVDASVQYLAMGAHFSRDVINRPGFAKLFFDAASEEREHAMKLI 329 ++H + ++ Q + E DAS +YLAM A R+ A + + EEREH +K+ Sbjct: 10 SLHESVEKLLNLQSKIESDASTKYLAMAAWLDRNGFENT--AGYMYKQSEEEREHFLKVF 67 Query: 330 DYLLMRG 350 Y+ G Sbjct: 68 KYITEMG 74 >SB_7503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 237 HFSRDVINRPGFAKLFFDAASEEREHA 317 HF RD IN PGF K F A+ EE EHA Sbjct: 32 HFDRDDINLPGFNKFFKKASKEEWEHA 58 >SB_23051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2141 Score = 30.7 bits (66), Expect = 0.46 Identities = 20/79 (25%), Positives = 30/79 (37%) Frame = -2 Query: 344 HEQVVDQLHRMLPLFASRVEEQLRESWTIDHVTGEMGTHCQILYGRVHLSLYLRVHAVFT 165 H +V H+ L + A + +WT H+T TH HL++ R H T Sbjct: 401 HLTIVTWTHKHLTIVAWTHKHLTIVTWTHKHLTSGTWTH-------KHLTIVTRTHKHLT 453 Query: 164 RIVHCHPFGGYICWVHVTL 108 + H + W H L Sbjct: 454 IVTRTHKHLTIVTWTHKDL 472 >SB_56909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1379 Score = 29.1 bits (62), Expect = 1.4 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 237 HFSRDVINRPGFAKLFFDAASE 302 HF+ IN+PG ++ FDAASE Sbjct: 350 HFAVTNINKPGKLRIIFDAASE 371 >SB_30861| Best HMM Match : Peptidase_A17 (HMM E-Value=2.1e-40) Length = 1740 Score = 29.1 bits (62), Expect = 1.4 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 237 HFSRDVINRPGFAKLFFDAASE 302 HF+ IN+PG ++ FDAASE Sbjct: 868 HFAVTNINKPGKLRIIFDAASE 889 >SB_16785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 29.1 bits (62), Expect = 1.4 Identities = 20/65 (30%), Positives = 28/65 (43%) Frame = -2 Query: 254 HVTGEMGTHCQILYGRVHLSLYLRVHAVFTRIVHCHPFGGYICWVHVTLYSDSRRRDSQG 75 HVTG+ + + G R+H H H GG + +HVT DSR + G Sbjct: 58 HVTGDDDSRIHVTGGDDS-----RIHVTGGDDSHIHVTGGDVSRIHVTGGDDSRIHVTGG 112 Query: 74 TDDCK 60 DD + Sbjct: 113 GDDSR 117 >SB_44028| Best HMM Match : RVT_1 (HMM E-Value=1.3) Length = 249 Score = 29.1 bits (62), Expect = 1.4 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 237 HFSRDVINRPGFAKLFFDAASE 302 HF+ IN+PG ++ FDAASE Sbjct: 30 HFAVTNINKPGKLRIIFDAASE 51 >SB_25615| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-10) Length = 475 Score = 29.1 bits (62), Expect = 1.4 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 237 HFSRDVINRPGFAKLFFDAASE 302 HF+ IN+PG ++ FDAASE Sbjct: 151 HFAVTNINKPGKLRIIFDAASE 172 >SB_5393| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1244 Score = 29.1 bits (62), Expect = 1.4 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 237 HFSRDVINRPGFAKLFFDAASE 302 HF+ IN+PG ++ FDAASE Sbjct: 667 HFAVTNINKPGKLRIIFDAASE 688 >SB_616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1515 Score = 29.1 bits (62), Expect = 1.4 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 237 HFSRDVINRPGFAKLFFDAASE 302 HF+ IN+PG ++ FDAASE Sbjct: 945 HFAVTNINKPGKLRIIFDAASE 966 >SB_23890| Best HMM Match : Oxidored_q4 (HMM E-Value=1) Length = 317 Score = 28.7 bits (61), Expect = 1.9 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +3 Query: 51 ALFLAIVGTLAVSTPAIAIQCHVNPANVSSE 143 A+ +A+ +A++ I ++CH+NP N + E Sbjct: 202 AMAMAMAMAMAMAIIMIVVRCHINPRNKTDE 232 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 1.9 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 233 CPFLP*RDQSSRIREAVLRRG*RREGACDEADRLLA 340 CP LP R+R VLR G E C A LA Sbjct: 26 CPLLPSTSSPHRVRFRVLRNGDPLESTCRHASLALA 61 >SB_45259| Best HMM Match : CH (HMM E-Value=0.00071) Length = 1032 Score = 27.9 bits (59), Expect = 3.3 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 162 PCKDSMHAQIQT-EVDASVQYLAMGAHFSRDVINR 263 PC S+H + + D VQ +A+ HFS+DV R Sbjct: 360 PCT-SLHLYLPARDFDHEVQSIAISGHFSKDVTER 393 >SB_26997| Best HMM Match : WD40 (HMM E-Value=1.3e-08) Length = 175 Score = 27.9 bits (59), Expect = 3.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 193 CICACMLSLQGLCIVTHSED 134 C C M QG C+VT SED Sbjct: 98 CFCPLMSFRQGACVVTGSED 117 >SB_43840| Best HMM Match : NDK (HMM E-Value=0) Length = 786 Score = 27.9 bits (59), Expect = 3.3 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +2 Query: 116 REPSKCILRMGDNA---QSL*RQHARANTN*GGRVRTISGNGCPFL 244 ++ SKC+ R + ++ R + + + GGR R+ +GN PFL Sbjct: 42 KDKSKCLFRCSNGVLRNTAIRRVFSSQSGSSGGRSRSFAGNAAPFL 87 >SB_31035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 27.9 bits (59), Expect = 3.3 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 207 RPPQFVFARACCLYKDCALSPI 142 R P+FV R C L+ C L PI Sbjct: 19 RRPRFVALRQCSLFNSCPLPPI 40 >SB_57416| Best HMM Match : rve (HMM E-Value=0.0011) Length = 807 Score = 27.5 bits (58), Expect = 4.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 237 HFSRDVINRPGFAKLFFDAASEEREHAM 320 HF N+PG ++ FDAA++ R +++ Sbjct: 138 HFGVTSANKPGCVRIVFDAAAKTRTNSL 165 >SB_40777| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 27.5 bits (58), Expect = 4.3 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = -3 Query: 214 TDASTSVCI---CACMLSLQGLCIVTHSEDTFAGFT*HCIAIAGV 89 +D + VCI C+ +++LQGL ++ F+ CI AG+ Sbjct: 69 SDLAVGVCIQPLCSAVMALQGLGVMAKHCTLVGAFSVLCIYFAGI 113 >SB_28841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -2 Query: 359 HKLSPHEQVVDQLHRMLPLFASRVEEQLRESWTIDH 252 H L+ H+Q ++ M+P SRV E R+ ++ H Sbjct: 3 HLLATHQQFDQEVPHMIPQLQSRVLETRRKLTSLQH 38 >SB_35800| Best HMM Match : 7tm_1 (HMM E-Value=3e-05) Length = 301 Score = 27.5 bits (58), Expect = 4.3 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Frame = -2 Query: 230 HCQILYGRVHLSLYLRVHAVFTRIVHCHPFGGY---IC--WVHVTLYSDSRRRDS 81 HC + RVH +Y+RV F + + +G Y +C W H SD+ R++ Sbjct: 177 HCSVRGDRVHGGVYVRVARPF-NASYLYRYGRYATLLCATWPHKLYVSDNNGRNT 230 >SB_46811| Best HMM Match : Ferritin (HMM E-Value=0.0021) Length = 73 Score = 27.1 bits (57), Expect = 5.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 291 AASEEREHAMKLIDYLLMRG 350 A+ EEREHA KL + L RG Sbjct: 3 ASHEEREHAEKLAKFQLQRG 22 >SB_58376| Best HMM Match : M20_dimer (HMM E-Value=0.00027) Length = 517 Score = 27.1 bits (57), Expect = 5.7 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = -2 Query: 296 SRVEEQLRESWTIDHVTGEMGTHCQILYGRVHLSLYLR 183 S + +Q++ +W + + E G I+ + L +YLR Sbjct: 326 SAMRQQMKPTWRVHSIIAEGGVKPNIIPDKTKLEIYLR 363 >SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6406 Score = 27.1 bits (57), Expect = 5.7 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 Query: 266 RIREAVLRRG*RREGACDEADRLLAHEGRAY 358 R EA++ +G EGACDE R L RA+ Sbjct: 3621 RALEAIISQGDAFEGACDEFLRWLTKTERAH 3651 >SB_6592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1228 Score = 27.1 bits (57), Expect = 5.7 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 69 VGTLAVSTPAIAIQCHVNPANVSSEWVTMHNPCKDSMHAQIQTEVDAS 212 V TL+ PA+A+ +N AN S T+ +P H Q+ E + + Sbjct: 91 VKTLSPDIPALALYPSLNIANKQSLHRTLSDPGSPPGHTQVCQETEVA 138 >SB_3591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1585 Score = 26.6 bits (56), Expect = 7.6 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -2 Query: 326 QLHRMLPLFASRVEEQLRESWTIDHVTGEMGTH 228 Q+H LP++A RV L W + H T + H Sbjct: 141 QMHSSLPVWAIRVIRALLSLWQLQHRTECLKQH 173 >SB_21441| Best HMM Match : zf-A20 (HMM E-Value=2.2) Length = 308 Score = 26.2 bits (55), Expect = 10.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 56 ISCNRRYPGCLYACYRYTMSREPSK 130 ++C+R G C RYT+ RE SK Sbjct: 211 VTCSRGSQGPGAGCVRYTIGRESSK 235 >SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 549 Score = 26.2 bits (55), Expect = 10.0 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = -2 Query: 326 QLHRMLPLFASRVEEQLRESWTIDHVTGEMGTHCQILYGRVH 201 ++H+ L VEE R+ +D M +CQ+ R+H Sbjct: 93 EIHKALEKGKPVVEEMTRKIRKLDTYLDSMSVNCQLTEERIH 134 >SB_1830| Best HMM Match : DUF331 (HMM E-Value=3.5) Length = 326 Score = 26.2 bits (55), Expect = 10.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 125 WVHVTLYSDSRRRDSQGTD 69 W+H LYSD R R++ G + Sbjct: 116 WMHSELYSDKRPRNTHGCE 134 >SB_57677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 359 Score = 26.2 bits (55), Expect = 10.0 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -2 Query: 383 GDKIADVRHKLSPHEQVVDQLHRMLPLFASRVEEQLRESWTIDHVTGEM 237 GD+++ + S E +R LP+ S+V+ E + I H GEM Sbjct: 242 GDQLSVLSQSDSESEHNRRYEYRSLPIIKSQVKRTNSEPFNIAHNVGEM 290 >SB_3090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 26.2 bits (55), Expect = 10.0 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -2 Query: 176 AVFTRIVHCHPFGGYICWVHVTLYSDSRRRDSQGTDDCKK 57 AV ++ HP + +++ + +DS+ R S DDC K Sbjct: 224 AVKNQVKLTHPDSPELAFLYGVIITDSKDRYSDDPDDCTK 263 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,349,171 Number of Sequences: 59808 Number of extensions: 295775 Number of successful extensions: 893 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 833 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 892 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 715479706 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -