BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C01 (566 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 23 1.4 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 3.2 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 5.6 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 23.4 bits (48), Expect = 1.4 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 452 NSLEDVSSSAALIQQSTTVKNKDIRKFLDGLY 547 N+L S+ AL+ K+ I++FL G+Y Sbjct: 94 NTLNTCRSALALLLSPEVGKDHRIKRFLRGVY 125 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.2 bits (45), Expect = 3.2 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -3 Query: 252 LIMFST*EHTVLTAASSFLE---PNHFSTFNWRGLTMRMSTAKCLKF 121 L+MFS ++ V + + +L PN ++ F + T + KC+K+ Sbjct: 11 LLMFSYTDN-VSSTRTKYLRTNFPNFYNDFEVQRYTWKCENQKCVKY 56 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.4 bits (43), Expect = 5.6 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -3 Query: 423 LGELTTVTPGAIFTLLMYFSPRKLRISIIVF 331 L ++TP F + SPR +IS I F Sbjct: 19 LSHFLSITPNYDFENFVIISPRCDKISAICF 49 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,093 Number of Sequences: 336 Number of extensions: 2856 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13995094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -