BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_C01 (566 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 25 2.3 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 24 4.0 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 24.6 bits (51), Expect = 2.3 Identities = 19/98 (19%), Positives = 39/98 (39%) Frame = +2 Query: 197 KKELAAVRTVCSHVENMIKGVTKGFQYKMRAVYAHFPINCVTTEGNTIIEIRNFLGEKYI 376 + EL T + M++ + K + + H + V + I++IRN+LG+ + Sbjct: 947 RDELIRYSTALRDLTQMMRDIRKSRFSHLHKLTTHMALR-VKHKFTNIMQIRNYLGKLRV 1005 Query: 377 RRVKMAPGVTVVNSPKQKDELIIEGNSLEDVSSSAALI 490 + + ++VV + SL S A + Sbjct: 1006 NQEECRLSLSVVPRDANVQNAVSTTKSLSGGERSYATV 1043 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 23.8 bits (49), Expect = 4.0 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 325 SGDTVDREMSVHCTHLVLESLGHTFDHVFDMR 230 SG+T D + + H ++L TFD ++ R Sbjct: 243 SGETDDPDNPTYLVHQHTQNLDETFDMMYQWR 274 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 605,077 Number of Sequences: 2352 Number of extensions: 12487 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -