BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_B21 (144 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81542-10|CAB04419.4| 411|Caenorhabditis elegans Hypothetical p... 26 4.2 U40799-8|AAA81487.1| 552|Caenorhabditis elegans Hypothetical pr... 25 5.5 Z81556-2|CAB04525.2| 445|Caenorhabditis elegans Hypothetical pr... 25 9.7 U13876-6|AAA21175.2| 444|Caenorhabditis elegans Hypothetical pr... 25 9.7 >Z81542-10|CAB04419.4| 411|Caenorhabditis elegans Hypothetical protein F49A5.7 protein. Length = 411 Score = 25.8 bits (54), Expect = 4.2 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = -2 Query: 119 QLLLIRWLM*FKGYCNAMTVITSILLIQVYQSHN 18 Q L + WL+ G + +IT ++L+ + +H+ Sbjct: 13 QFLRLHWLIILIGVITEIVIITGVVLLTYFTTHH 46 >U40799-8|AAA81487.1| 552|Caenorhabditis elegans Hypothetical protein F42C5.9 protein. Length = 552 Score = 25.4 bits (53), Expect = 5.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +2 Query: 59 LQSWRYNSL*ITLTIVLTKAAFSDDC 136 + WRYN+ + IV + + F D C Sbjct: 509 ISPWRYNAAYLGAQIVASASTFEDSC 534 >Z81556-2|CAB04525.2| 445|Caenorhabditis elegans Hypothetical protein F58G1.2 protein. Length = 445 Score = 24.6 bits (51), Expect = 9.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 102 MVNVIQRLL*RHDCNNFYITNTSVSI 25 M +V R H C F+I++T+V+I Sbjct: 336 MAHVFSRTFQCHFCEEFFISDTAVTI 361 >U13876-6|AAA21175.2| 444|Caenorhabditis elegans Hypothetical protein F57B9.8 protein. Length = 444 Score = 24.6 bits (51), Expect = 9.7 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 62 QSWRYNSL*ITLTIVLTKAAFSD 130 QSW N IT+T VL + AF + Sbjct: 106 QSWELNHADITMTKVLGEGAFGE 128 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,794,028 Number of Sequences: 27780 Number of extensions: 30128 Number of successful extensions: 50 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 12,740,198 effective HSP length: 28 effective length of database: 11,962,358 effective search space used: 227284802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -