Samia BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0002_B21
         (144 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g31780.1 68414.m03901 conserved oligomeric Golgi complex comp...    25   5.2  
At3g56890.1 68416.m06328 F-box family protein-related predicted ...    25   9.1  

>At1g31780.1 68414.m03901 conserved oligomeric Golgi complex
           component-related / COG complex component-related
           similar to Conserved oligomeric Golgi complex component
           6 (Swiss-Prot:Q9Y2V7) [Homo sapiens];
          Length = 706

 Score = 25.4 bits (53), Expect = 5.2
 Identities = 14/43 (32%), Positives = 23/43 (53%)
 Frame = -1

Query: 144 QISQSSLKAAFVNTMVNVIQRLL*RHDCNNFYITNTSVSIT*H 16
           Q +++  K   +N +  + Q LL RHD  + Y+TN  + I  H
Sbjct: 541 QNNETPSKIFLINCLCAIQQPLL-RHDVASQYVTNIGLMIENH 582


>At3g56890.1 68416.m06328 F-box family protein-related predicted
           proteins - Arabidopsis thaliana; contains TIGRFAM
           TIGR01640: F-box protein interaction domain
          Length = 219

 Score = 24.6 bits (51), Expect = 9.1
 Identities = 10/13 (76%), Positives = 11/13 (84%)
 Frame = +1

Query: 1   ARGNIVLCD*YTC 39
           ARG+IVLC  YTC
Sbjct: 127 ARGDIVLCMKYTC 139


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,555,797
Number of Sequences: 28952
Number of extensions: 26602
Number of successful extensions: 34
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 34
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34
length of database: 12,070,560
effective HSP length: 28
effective length of database: 11,259,904
effective search space used: 213938176
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)