BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_B20 (297 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93242-1|CAI42724.1| 1630|Homo sapiens Nance-Horan syndrome (con... 28 6.2 AY456993-1|AAS13456.1| 1473|Homo sapiens Nance-Horan syndrome pr... 28 6.2 AY456992-1|AAS13455.1| 1474|Homo sapiens Nance-Horan syndrome pr... 28 6.2 AY436752-1|AAR03104.1| 1630|Homo sapiens Nance-Horan syndrome pr... 28 6.2 AL845433-1|CAI41241.1| 1630|Homo sapiens Nance-Horan syndrome (c... 28 6.2 >Z93242-1|CAI42724.1| 1630|Homo sapiens Nance-Horan syndrome (congenital cataracts and dental anomalies) protein. Length = 1630 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = -1 Query: 294 PTHTIRRYMSSVMDLEIHYFEQISNLCHGQQHSMQSTLRRIFPDKLCVYKVIL 136 PTH + +V++ H+ + H +Q+++ TLR P L + IL Sbjct: 1065 PTHLDLSALHNVLNKPFHHRHPLHVFTHNKQNTVGETLRSNPPPSLAITPTIL 1117 >AY456993-1|AAS13456.1| 1473|Homo sapiens Nance-Horan syndrome protein isoform 2 protein. Length = 1473 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = -1 Query: 294 PTHTIRRYMSSVMDLEIHYFEQISNLCHGQQHSMQSTLRRIFPDKLCVYKVIL 136 PTH + +V++ H+ + H +Q+++ TLR P L + IL Sbjct: 908 PTHLDLSALHNVLNKPFHHRHPLHVFTHNKQNTVGETLRSNPPPSLAITPTIL 960 >AY456992-1|AAS13455.1| 1474|Homo sapiens Nance-Horan syndrome protein isoform 1 protein. Length = 1474 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = -1 Query: 294 PTHTIRRYMSSVMDLEIHYFEQISNLCHGQQHSMQSTLRRIFPDKLCVYKVIL 136 PTH + +V++ H+ + H +Q+++ TLR P L + IL Sbjct: 909 PTHLDLSALHNVLNKPFHHRHPLHVFTHNKQNTVGETLRSNPPPSLAITPTIL 961 >AY436752-1|AAR03104.1| 1630|Homo sapiens Nance-Horan syndrome protein protein. Length = 1630 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = -1 Query: 294 PTHTIRRYMSSVMDLEIHYFEQISNLCHGQQHSMQSTLRRIFPDKLCVYKVIL 136 PTH + +V++ H+ + H +Q+++ TLR P L + IL Sbjct: 1065 PTHLDLSALHNVLNKPFHHRHPLHVFTHNKQNTVGETLRSNPPPSLAITPTIL 1117 >AL845433-1|CAI41241.1| 1630|Homo sapiens Nance-Horan syndrome (congenital cataracts and dental anomalies) protein. Length = 1630 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = -1 Query: 294 PTHTIRRYMSSVMDLEIHYFEQISNLCHGQQHSMQSTLRRIFPDKLCVYKVIL 136 PTH + +V++ H+ + H +Q+++ TLR P L + IL Sbjct: 1065 PTHLDLSALHNVLNKPFHHRHPLHVFTHNKQNTVGETLRSNPPPSLAITPTIL 1117 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 41,997,901 Number of Sequences: 237096 Number of extensions: 706743 Number of successful extensions: 1030 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1025 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1030 length of database: 76,859,062 effective HSP length: 75 effective length of database: 59,076,862 effective search space used: 1358767826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -