BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_B20 (297 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 25 0.20 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 25 0.20 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 25 0.20 AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding prote... 23 1.1 AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-bind... 23 1.1 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 2.4 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 20 7.4 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 19 9.8 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 19 9.8 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 25.0 bits (52), Expect = 0.20 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -1 Query: 291 THTIRRYMSSVMDLEIHYFEQISNLCHGQQHSMQSTLRRI 172 T +IR +++ + + YF LCH + S T+R I Sbjct: 127 TRSIRLTITASCPMNLQYFPMDRQLCHIEIESFGYTMRDI 166 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 25.0 bits (52), Expect = 0.20 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -1 Query: 291 THTIRRYMSSVMDLEIHYFEQISNLCHGQQHSMQSTLRRI 172 T +IR +++ + + YF LCH + S T+R I Sbjct: 127 TRSIRLTITASCPMNLQYFPMDRQLCHIEIESFGYTMRDI 166 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 25.0 bits (52), Expect = 0.20 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -1 Query: 291 THTIRRYMSSVMDLEIHYFEQISNLCHGQQHSMQSTLRRI 172 T +IR +++ + + YF LCH + S T+R I Sbjct: 66 TRSIRLTITASCPMNLQYFPMDRQLCHIEIESFGYTMRDI 105 >AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding protein ASP2 protein. Length = 142 Score = 22.6 bits (46), Expect = 1.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 162 KLCVYKVILLVY*LTNYIKPVYKI 91 K CV K I ++ Y++PVYK+ Sbjct: 70 KACVMKRIEMLKGTELYVEPVYKM 93 >AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-binding protein ASP2 protein. Length = 142 Score = 22.6 bits (46), Expect = 1.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 162 KLCVYKVILLVY*LTNYIKPVYKI 91 K CV K I ++ Y++PVYK+ Sbjct: 70 KACVMKRIEMLKGTELYVEPVYKM 93 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.4 bits (43), Expect = 2.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 230 KFRIYVTASSTQCKARYGEYSQ 165 KFR +V+ S + RY Y+Q Sbjct: 452 KFRRWVSTMSRPFEVRYDPYTQ 473 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 19.8 bits (39), Expect = 7.4 Identities = 9/36 (25%), Positives = 13/36 (36%) Frame = -2 Query: 257 WTLRFIILSKFRIYVTASSTQCKARYGEYSQINYAC 150 W + I F IY + + G YS + C Sbjct: 166 WLIALISAIPFAIYTKVNLVEYPPESGNYSADSAMC 201 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 19.4 bits (38), Expect = 9.8 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = -1 Query: 282 IRRYMSSVMDLEIHYF 235 +R + +V+D E+H F Sbjct: 47 VRGFPRTVLDKEVHVF 62 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 19.4 bits (38), Expect = 9.8 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = -1 Query: 282 IRRYMSSVMDLEIHYF 235 +R + +V+D E+H F Sbjct: 47 VRGFPRTVLDKEVHVF 62 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,185 Number of Sequences: 438 Number of extensions: 1647 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 6119169 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -