BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_B17 (410 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC757.07c |ctt1|cta1|catalase|Schizosaccharomyces pombe|chr 3|... 27 1.5 SPBC19G7.08c |||arrestin|Schizosaccharomyces pombe|chr 2|||Manual 25 4.6 SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces pomb... 25 4.6 SPAC3C7.10 |pex13||peroxin-13|Schizosaccharomyces pombe|chr 1|||... 25 6.1 SPBC713.04c |||U3 snoRNP-associated protein Utp1|Schizosaccharom... 25 6.1 SPAC1006.05c |och1||alpha-1,6-mannosyltransferase Och1 |Schizosa... 25 6.1 SPBC409.08 |||spermine family transporter |Schizosaccharomyces p... 24 8.0 >SPCC757.07c |ctt1|cta1|catalase|Schizosaccharomyces pombe|chr 3|||Manual Length = 512 Score = 26.6 bits (56), Expect = 1.5 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 156 AGFSLLRAIPGIQISNDRQRARSLSSVPDLH 248 AGFS +PGI++S D S PD H Sbjct: 318 AGFSPSHMVPGIEVSADPVLQVRTFSYPDTH 348 >SPBC19G7.08c |||arrestin|Schizosaccharomyces pombe|chr 2|||Manual Length = 483 Score = 25.0 bits (52), Expect = 4.6 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +3 Query: 180 IPGIQISNDRQRARSLSS--VPDLHASHETIAIPPNSQSY 293 IP + ISN + L+ + LH+ H IPPN +Y Sbjct: 70 IPSLGISNHLSDNKCLARQVLFPLHSEHPENNIPPNDNNY 109 >SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces pombe|chr 2|||Manual Length = 662 Score = 25.0 bits (52), Expect = 4.6 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 113 SRPRTLPLVCSACLGSHCDSVTQISNLSLEL 21 SR P CL SH DSVT I L+ +L Sbjct: 200 SRQAETPRKFRYCLDSHADSVTCIDALTGDL 230 >SPAC3C7.10 |pex13||peroxin-13|Schizosaccharomyces pombe|chr 1|||Manual Length = 288 Score = 24.6 bits (51), Expect = 6.1 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -2 Query: 382 LPSASEVPGSGPASSFE-LESVSGLAAADA 296 +P + +PG+GP SS + +ES+ G + A Sbjct: 70 VPLETNLPGNGPISSLQVIESIVGAVGSIA 99 >SPBC713.04c |||U3 snoRNP-associated protein Utp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 854 Score = 24.6 bits (51), Expect = 6.1 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +1 Query: 343 RLGQILVPHWRSVGYMLR 396 +LGQ+LV W+S Y+L+ Sbjct: 317 KLGQLLVWEWQSESYVLK 334 >SPAC1006.05c |och1||alpha-1,6-mannosyltransferase Och1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 396 Score = 24.6 bits (51), Expect = 6.1 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 Query: 117 MFSPEDSAPRLQCLPWLPLRLRYANIKSVTRIE 19 ++S D+AP W+P R NI+ + IE Sbjct: 226 IYSDIDTAPLKHINNWIPREYRKRNIRLIVGIE 258 >SPBC409.08 |||spermine family transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 539 Score = 24.2 bits (50), Expect = 8.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 361 VPHWRSVGYMLRTPFL 408 VP WR VG + +PF+ Sbjct: 406 VPEWRLVGMCIASPFI 421 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,631,128 Number of Sequences: 5004 Number of extensions: 28916 Number of successful extensions: 55 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 142254980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -