BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_B17 (410 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1457 - 33741048-33741146,33741647-33741760,33741938-337420... 29 1.9 06_02_0007 - 10533689-10534565,10535054-10535946 28 3.3 10_08_0425 - 17806117-17806401,17806862-17806984,17807076-178072... 27 4.4 06_03_1259 - 28800954-28802468 27 4.4 09_04_0520 + 18286435-18287279,18287818-18288697 27 7.7 02_01_0512 - 3711475-3711600,3711903-3712019,3712099-3712176,371... 27 7.7 >04_04_1457 - 33741048-33741146,33741647-33741760,33741938-33742052, 33742154-33742560,33743342-33743476,33743576-33743970, 33744225-33744916,33745014-33745097,33745195-33745286, 33745374-33745457,33745535-33745714,33746258-33746302, 33746399-33746692,33747199-33747585,33747713-33747899, 33748042-33748118,33748936-33749067,33749315-33749416, 33749744-33749827,33749902-33749992,33750105-33750178, 33750644-33750664,33751433-33751477,33752427-33752561, 33752693-33752752 Length = 1376 Score = 28.7 bits (61), Expect = 1.9 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -2 Query: 382 LPSASEVPGSGPASSFELESVSGLAAADAS*LCEFGGI 269 +PS P SGP +S E S SG A+ AS + G+ Sbjct: 977 VPSMKYAPSSGPTTSNEGASTSGAASQTASGVLSGSGV 1014 >06_02_0007 - 10533689-10534565,10535054-10535946 Length = 589 Score = 27.9 bits (59), Expect = 3.3 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 55 ESQWEPRQALQTRGRVLGREHFQ 123 +S+WE Q ++TR +LG HF+ Sbjct: 174 DSRWEAIQMIRTRDGILGLSHFK 196 >10_08_0425 - 17806117-17806401,17806862-17806984,17807076-17807222, 17807307-17807450,17808557-17808668,17808762-17808898, 17809016-17809156,17810921-17811004,17811275-17811742, 17811858-17811936,17812494-17812506,17813884-17814460, 17814502-17814774,17814899-17815045,17815354-17815413, 17816124-17816510 Length = 1058 Score = 27.5 bits (58), Expect = 4.4 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -2 Query: 385 TLPSASEVPGSGPASSFELESVSGLAAA 302 T P A+EVP + PAS E SG+ AA Sbjct: 12 TNPEAAEVPSAAPASESEGPFDSGVVAA 39 >06_03_1259 - 28800954-28802468 Length = 504 Score = 27.5 bits (58), Expect = 4.4 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +3 Query: 159 GFSLLRAIPGIQISNDRQRARSLSSVPDLHASHE 260 G L P +++ Q R ++S+PD H +H+ Sbjct: 78 GARCLATAPTVRLHKPHQAPRPVASLPDAHTTHD 111 >09_04_0520 + 18286435-18287279,18287818-18288697 Length = 574 Score = 26.6 bits (56), Expect = 7.7 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +1 Query: 55 ESQWEPRQALQTRGRVLGREHFQ 123 +S+WE Q ++T+ +LG HF+ Sbjct: 158 DSRWEAIQTVKTKDGILGLNHFR 180 >02_01_0512 - 3711475-3711600,3711903-3712019,3712099-3712176, 3712714-3712836,3713125-3713400 Length = 239 Score = 26.6 bits (56), Expect = 7.7 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 394 AAYTLPSASEVPGSGPASSFELESVSGLAAAD 299 +A PS +E+PGSG + +L G AD Sbjct: 58 SAAAAPSFAEIPGSGGVKALDLREGPGEVPAD 89 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,322,484 Number of Sequences: 37544 Number of extensions: 219714 Number of successful extensions: 586 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 730630428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -