BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_B16 (425 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 24 2.0 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 24 2.0 Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. 23 4.5 L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. 23 6.0 AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. 22 7.9 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 24.2 bits (50), Expect = 2.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +2 Query: 359 RRIQKQTWPLIKQERYRNSTD 421 RR+ Q+WP + Y+N+ D Sbjct: 238 RRMMMQSWPCKSEVMYKNTLD 258 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 24.2 bits (50), Expect = 2.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +2 Query: 359 RRIQKQTWPLIKQERYRNSTD 421 RR+ Q+WP + Y+N+ D Sbjct: 238 RRMMMQSWPCKSEVMYKNTLD 258 >Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. Length = 115 Score = 23.0 bits (47), Expect = 4.5 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 323 KYKDAMPAVKQPRRIQKQTWPLIKQERYRNSTDI 424 K A VK+P R + T L + RY+ ST++ Sbjct: 26 KSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL 59 >L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. Length = 154 Score = 22.6 bits (46), Expect = 6.0 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +1 Query: 283 QVFTHHTICQNNIKIQRRHASGETAQKNTKTNMAIDK 393 + + HH ++N + + A+GE A K KT + K Sbjct: 35 ETWLHHYTPESNRQSAQWTATGEPAPKRGKTQKSAGK 71 >AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. Length = 136 Score = 22.2 bits (45), Expect = 7.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 347 VKQPRRIQKQTWPLIKQERYRNSTDI 424 VK+P R + T L + RY+ ST++ Sbjct: 36 VKKPHRYRPGTVALREIRRYQKSTEL 61 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 342,013 Number of Sequences: 2352 Number of extensions: 4823 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 34867302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -