BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_B14 (418 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25657| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) 48 2e-06 SB_28916| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_55143| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) 44 5e-05 SB_38742| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_47930| Best HMM Match : Vicilin_N (HMM E-Value=1.3) 28 2.7 SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_52654| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 27 6.2 SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) 27 8.2 SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) 27 8.2 SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) 27 8.2 >SB_25657| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) Length = 829 Score = 48.4 bits (110), Expect = 2e-06 Identities = 28/82 (34%), Positives = 41/82 (50%) Frame = +2 Query: 158 CYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHAN 337 CYY + S R P D++P L CTH+L+ A + T+K+ EN H Sbjct: 25 CYYTNWSQYRPKGGTFWPEDIDPFL--CTHILFSFAKVNQTTHKLDIYEEN-----DHEL 77 Query: 338 YRAITNLKRQFPQLRVFLTVGG 403 Y+ I LK+ P+L+ + VGG Sbjct: 78 YQRINALKKINPKLKTQIAVGG 99 Score = 44.0 bits (99), Expect = 5e-05 Identities = 26/83 (31%), Positives = 42/83 (50%) Frame = +2 Query: 155 LCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHA 334 +CYY + S R P D++P L CTH+++ + + T+ M +N D D Sbjct: 409 VCYYTNWSQYRPKGGTFWPEDIDPHL--CTHVIHSFSKVNLTTHVMEKYEKN-DFDL--- 462 Query: 335 NYRAITNLKRQFPQLRVFLTVGG 403 Y+ I LK+ P+L+ + VGG Sbjct: 463 -YKRINALKKINPKLKTQIAVGG 484 >SB_28916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 807 Score = 48.0 bits (109), Expect = 3e-06 Identities = 28/83 (33%), Positives = 43/83 (51%) Frame = +2 Query: 155 LCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHA 334 +CY+ + + R + LP D++P L CTH++Y A I T K+ + N D Sbjct: 401 VCYFTNWAQYRPDPVKFLPKDIDPLL--CTHIVYAFAKIDPATNKIGTYEWNDD-----R 453 Query: 335 NYRAITNLKRQFPQLRVFLTVGG 403 Y+ I +LK + P L+ L VGG Sbjct: 454 LYKEINDLKLKNPSLKTLLAVGG 476 >SB_55143| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) Length = 270 Score = 44.0 bits (99), Expect = 5e-05 Identities = 29/84 (34%), Positives = 46/84 (54%), Gaps = 1/84 (1%) Frame = +2 Query: 155 LCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGI-QADTYKMVSLNENLDIDRAH 331 +CY+ + S R+ +A+ P D+ PA CTHL+Y A I Q + M N+ D+ + Sbjct: 22 VCYHTNWSQYRQGRAKFWPEDI-PA-DLCTHLMYSFAKINQKNELAMYEWND----DKLY 75 Query: 332 ANYRAITNLKRQFPQLRVFLTVGG 403 + A LK++ P+L+ L VGG Sbjct: 76 PRFNA---LKQKNPELKTLLAVGG 96 >SB_38742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 38.7 bits (86), Expect = 0.002 Identities = 25/83 (30%), Positives = 42/83 (50%) Frame = +2 Query: 155 LCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHA 334 +CYY + + R A+ P +++P+L CTH++Y A + AD K+ N A Sbjct: 25 VCYYTNWAQYR-GLAKYTPDNIDPSL--CTHIVYAFAKMNADNSKLAMFEWN-----DAA 76 Query: 335 NYRAITNLKRQFPQLRVFLTVGG 403 Y+ + +LK ++ L VGG Sbjct: 77 MYKKVNDLKSS-SNMKTLLAVGG 98 >SB_47930| Best HMM Match : Vicilin_N (HMM E-Value=1.3) Length = 769 Score = 28.3 bits (60), Expect = 2.7 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 81 PSPGYWR*RLRLPTTQHHLVAKAKSSATMTARAISENLKHVCCLRTW 221 P P R R PT H K + T T R ++ +KHV +RT+ Sbjct: 316 PEPTDKRRRDEPPTDIHERRRYRKVTKTKTIRTVTTTVKHVVTVRTY 362 >SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1670 Score = 28.3 bits (60), Expect = 2.7 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 81 PSPGYWR*RLRLPTTQHHLVAKAKSSATMTARAISENLKHVCCLRTW 221 P P R R PT H K + T T R ++ +KHV +RT+ Sbjct: 983 PEPTDKRRRDEPPTDIHERRRYRKVTKTKTIRTVTTTVKHVVTVRTY 1029 >SB_52654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.1 bits (57), Expect = 6.2 Identities = 9/33 (27%), Positives = 21/33 (63%) Frame = +3 Query: 135 LVAKAKSSATMTARAISENLKHVCCLRTWSLLF 233 LVA+ K++ TAR + + +H+ + W++++ Sbjct: 65 LVARCKNALIQTARTVVKRHRHMIAQQRWTVVY 97 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 27.1 bits (57), Expect = 6.2 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -2 Query: 300 SETILYVSAWMPADLYSRWVQNERAGSKSVGSI 202 + T++ +AW D Y W+Q + G+ V S+ Sbjct: 398 ASTVIIDTAWCAGDSYDCWLQVDLGGTHCVTSV 430 >SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) Length = 362 Score = 26.6 bits (56), Expect = 8.2 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 267 ASKLTHIKWFHSMRIWTLIGRTLIIERSQT*KDSFLN 377 A+ L + ++ +W L+G L + Q KDS+LN Sbjct: 230 ANNLYSVDYYVKKVVWDLMGEVLHYKHQQGTKDSWLN 266 >SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) Length = 279 Score = 26.6 bits (56), Expect = 8.2 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 267 ASKLTHIKWFHSMRIWTLIGRTLIIERSQT*KDSFLN 377 A+ L + ++ +W L+G L + Q KDS+LN Sbjct: 147 ANNLYSVDYYVKKVVWDLMGEVLHYKHQQGTKDSWLN 183 >SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) Length = 532 Score = 26.6 bits (56), Expect = 8.2 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 267 ASKLTHIKWFHSMRIWTLIGRTLIIERSQT*KDSFLN 377 A+ L + ++ +W L+G L + Q KDS+LN Sbjct: 400 ANNLYSVDYYVKKVVWDLMGEVLHYKHQQGTKDSWLN 436 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,618,488 Number of Sequences: 59808 Number of extensions: 227311 Number of successful extensions: 597 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 593 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 777158991 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -