BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_B11 (571 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 29 0.11 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 9.3 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 29.1 bits (62), Expect = 0.11 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 3/62 (4%) Frame = -3 Query: 455 ILLADKVRITGCSVDCNLARACSCSFSILTPSIILLK--PSKASWRVSVRDFNW-WG*WL 285 I LA V +T V C L A C+F + P I + P + V +F+W W WL Sbjct: 66 INLAVPVTVTLLLVFCGLREADVCAFDNILPDYIFFRMPPIYYLFDYVVNEFSWLWLLWL 125 Query: 284 SS 279 S Sbjct: 126 LS 127 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 22.6 bits (46), Expect = 9.3 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +1 Query: 151 NGISKIVFTHIANLHRLMIDWVKIRDKGLKICKAI 255 NG+ ++ HI N H M+D + + K+C + Sbjct: 270 NGLVQL--NHINNSHGRMLDLLYANNAAAKLCSPV 302 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 559,251 Number of Sequences: 2352 Number of extensions: 10638 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -