BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_B08 (494 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.03c |rpl402|rpl4-2, rpl4|60S ribosomal protein L2|Schizo... 184 5e-48 SPBC1711.06 |rpl401|rpl4-1, rpl4|60S ribosomal protein L2|Schizo... 184 7e-48 SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pomb... 27 2.1 SPAPYUG7.06 |mug67||PPPDE peptidase family |Schizosaccharomyces ... 26 2.7 SPAC1F8.06 |fta5|sma5|Sim4 and Mal2 associated |Schizosaccharomy... 25 4.7 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 25 8.3 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 25 8.3 >SPBP8B7.03c |rpl402|rpl4-2, rpl4|60S ribosomal protein L2|Schizosaccharomyces pombe|chr 2|||Manual Length = 363 Score = 184 bits (449), Expect = 5e-48 Identities = 82/113 (72%), Positives = 95/113 (84%) Frame = +1 Query: 79 LSVARPLVSVYSEKSEVVAGASLPLPFVFKAPIRPDLVNDVHVSMSKNARQPYCVSKEAG 258 ++ ARP VS+YS K V+ ++ LPFVFKAPIRPDLV VH +++KN RQPY VS++AG Sbjct: 1 MAAARPTVSIYS-KDGSVSSETIALPFVFKAPIRPDLVRSVHTAVAKNKRQPYAVSEKAG 59 Query: 259 HQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 417 HQTSAESWGTGRA+ARIPRV GGGTHRSGQ AFGNMCR GRMFAPTK WR+WH Sbjct: 60 HQTSAESWGTGRALARIPRVGGGGTHRSGQAAFGNMCRSGRMFAPTKTWRKWH 112 >SPBC1711.06 |rpl401|rpl4-1, rpl4|60S ribosomal protein L2|Schizosaccharomyces pombe|chr 2|||Manual Length = 363 Score = 184 bits (448), Expect = 7e-48 Identities = 82/113 (72%), Positives = 95/113 (84%) Frame = +1 Query: 79 LSVARPLVSVYSEKSEVVAGASLPLPFVFKAPIRPDLVNDVHVSMSKNARQPYCVSKEAG 258 ++ ARP VS+Y+ K V+ +L LPFVFKAPIRPDLV VH +++KN RQPY VS++AG Sbjct: 1 MAAARPTVSIYN-KDGSVSSETLALPFVFKAPIRPDLVRSVHTAVAKNKRQPYAVSEKAG 59 Query: 259 HQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 417 HQTSAESWGTGRA+ARIPRV GGGTHRSGQ AFGNMCR GRMFAPTK WR+WH Sbjct: 60 HQTSAESWGTGRALARIPRVGGGGTHRSGQAAFGNMCRSGRMFAPTKTWRKWH 112 >SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pombe|chr 1|||Manual Length = 1778 Score = 26.6 bits (56), Expect = 2.1 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 197 SLTRSGLMGALNTNGRGSEAPATTSLF 117 S T SGL GA NTN + + T LF Sbjct: 593 STTTSGLFGASNTNNQAQTSNFGTGLF 619 >SPAPYUG7.06 |mug67||PPPDE peptidase family |Schizosaccharomyces pombe|chr 1|||Manual Length = 201 Score = 26.2 bits (55), Expect = 2.7 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = -3 Query: 459 GGHGSTSLP*VHATVPAPPRLGRREHTSAAAHVTECTLPR 340 G H V AT+P PP G R S A + CTLP+ Sbjct: 42 GAHEIPGSTGVFATMPRPPLEGCRWRCSIA--LPNCTLPK 79 >SPAC1F8.06 |fta5|sma5|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 1|||Manual Length = 385 Score = 25.4 bits (53), Expect = 4.7 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 439 SAVGSRDGASASTAWSARTYVRRGTCYRMHPAQIC 335 S V S ++ + S T+V T Y++ P QIC Sbjct: 132 STVSSTPVSTIYSGTSGTTFVSSSTTYQVIPTQIC 166 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 24.6 bits (51), Expect = 8.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 377 PPRHMLPNAPCPDLWVPPP 321 PP+ P P P + VPPP Sbjct: 1699 PPQMSAPTPPPPPMSVPPP 1717 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 24.6 bits (51), Expect = 8.3 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -1 Query: 377 PPRHMLPNAPCPDLWVPPPRTRGIRATARPVPQDSA 270 PP P P P + VPP +TA PVP SA Sbjct: 1192 PPPSEAPPVPKPSVGVPPVPP---PSTAPPVPTPSA 1224 Score = 24.6 bits (51), Expect = 8.3 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = -1 Query: 395 VGANIRPPRHMLPNAPCPDLWVPPPRTRGIRATARPVPQDSA 270 VG PP P P P +PP +A P P A Sbjct: 1205 VGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEA 1246 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,853,009 Number of Sequences: 5004 Number of extensions: 34229 Number of successful extensions: 99 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 194131776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -