BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_B03 (534 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 25 0.37 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 25 0.37 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 25 0.49 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.0 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 3.4 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 7.9 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 7.9 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 7.9 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 7.9 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 7.9 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 7.9 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 7.9 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 7.9 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 7.9 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 25.4 bits (53), Expect = 0.37 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 323 GDKVGASEATLLNMLNISPFSYGLVVKQVYDSGTIFAP 436 G+ G S +L ISP + GLV + + SGT+ AP Sbjct: 251 GESAGGSSVSLHL---ISPVTRGLVRRGILQSGTLNAP 285 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 25.4 bits (53), Expect = 0.37 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 323 GDKVGASEATLLNMLNISPFSYGLVVKQVYDSGTIFAP 436 G+ G S +L ISP + GLV + + SGT+ AP Sbjct: 251 GESAGGSSVSLHL---ISPVTRGLVRRGILQSGTLNAP 285 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 25.0 bits (52), Expect = 0.49 Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +1 Query: 16 EESHQGPS*NKSSSRKTASSHQGKC---WLCLHPWR 114 + QGP + + + + S H C W+C H WR Sbjct: 350 QSKDQGPPNDGNGNILSPSIHDNICSNGWICEHRWR 385 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 247 EERSLLRTKASVMSGNDDRQW 185 E R LRT A++++ N+ R W Sbjct: 1177 ELRPYLRTAAAILTWNEKRFW 1197 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 3.4 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 Query: 241 FLPGSFHPH 267 FLP S+HPH Sbjct: 311 FLPPSYHPH 319 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 422 YRSRTPV*QQDHTKRERC 369 YR + +D T+RERC Sbjct: 59 YRETSKERSRDRTERERC 76 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 422 YRSRTPV*QQDHTKRERC 369 YR + +D T+RERC Sbjct: 59 YRETSKERSRDRTERERC 76 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 422 YRSRTPV*QQDHTKRERC 369 YR + +D T+RERC Sbjct: 59 YRETSKERSRDRTERERC 76 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 422 YRSRTPV*QQDHTKRERC 369 YR + +D T+RERC Sbjct: 59 YRETSKERSRDRTERERC 76 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 422 YRSRTPV*QQDHTKRERC 369 YR + +D T+RERC Sbjct: 59 YRETSKERSRDRTERERC 76 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 422 YRSRTPV*QQDHTKRERC 369 YR + +D T+RERC Sbjct: 59 YRETSKERSRDRTERERC 76 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 422 YRSRTPV*QQDHTKRERC 369 YR + +D T+RERC Sbjct: 59 YRETSKERSRDRTERERC 76 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.0 bits (42), Expect = 7.9 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -1 Query: 249 WKKEVFSGPRPVL*AGMTTD 190 WK GP+PV G T D Sbjct: 29 WKSRGVVGPKPVPFFGTTKD 48 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.0 bits (42), Expect = 7.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 287 IEIINDVHILKPGDKVGASEATLLN 361 I I+N HIL+ K G S L+N Sbjct: 480 IGIVNQFHILQFITKNGTSNNYLIN 504 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,335 Number of Sequences: 438 Number of extensions: 3573 Number of successful extensions: 19 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15090993 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -