BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_A22 (271 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 21 6.1 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 21 6.1 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 21 6.1 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 21 6.1 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 21 6.1 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 21 6.1 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 21 6.1 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 21 6.1 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 21 6.1 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 21 6.1 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 21 6.1 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 21 6.1 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 21 6.1 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 21 6.1 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 21 6.1 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 21 6.1 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 21 6.1 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 21 6.1 DQ004401-1|AAY21240.1| 153|Anopheles gambiae lysozyme c-7 protein. 21 6.1 AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. 21 6.1 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 21 6.1 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 21 6.1 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 21 6.1 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 21 6.1 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 21 6.1 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 21 6.1 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 21 8.0 CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein ... 21 8.0 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 21 8.0 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 247 EHFDLRGNGFHCGT 260 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 262 EHFDLRGNGFHCGT 275 >DQ004401-1|AAY21240.1| 153|Anopheles gambiae lysozyme c-7 protein. Length = 153 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 200 TLSLEVLVLCVVATPS 247 TLSL ++ LC++ PS Sbjct: 11 TLSLAIVSLCLLGLPS 26 >AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 187 EHFDLRGNGFHCGT 200 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 187 EHFDLRGNGFHCGT 200 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 187 EHFDLRGNGFHCGT 200 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 187 EHFDLRGNGFHCGT 200 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 187 EHFDLRGNGFHCGT 200 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 KHTKLRGIGFVCGS 237 +H LRG GF CG+ Sbjct: 187 EHFDLRGNGFHCGT 200 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = -3 Query: 125 NSISKSIEMMISFKNNIQHVTGITHILKR 39 N I + + ++ K+N +T + H+L+R Sbjct: 108 NEILELSQNAVNLKSNYLELTELKHVLER 136 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 21.0 bits (42), Expect = 8.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 231 THKTNTSKLSVFTNLD 184 T + T + +VFTNLD Sbjct: 161 TERNTTVRKAVFTNLD 176 >CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein protein. Length = 277 Score = 21.0 bits (42), Expect = 8.0 Identities = 6/33 (18%), Positives = 17/33 (51%) Frame = -3 Query: 146 CLIIVPHNSISKSIEMMISFKNNIQHVTGITHI 48 C +++P K + + ++ +NN+ ++ I Sbjct: 80 CTLVIPQAKNKKGLFLTMTSQNNVTELSATLEI 112 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 21.0 bits (42), Expect = 8.0 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = +2 Query: 65 LHVGYYF*KISSFQLICLLNYEVQL 139 +H+ + +++S QL C L + L Sbjct: 337 VHIAWVSRRVASLQLFCRLKVQTSL 361 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 280,873 Number of Sequences: 2352 Number of extensions: 4912 Number of successful extensions: 48 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 54 effective length of database: 436,971 effective search space used: 15293985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -