BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_A22 (271 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-2863|AAF53626.1| 4010|Drosophila melanogaster CG5526-PA... 28 2.1 AE014296-910|AAF47948.2| 4390|Drosophila melanogaster CG17150-PA... 27 3.6 >AE014134-2863|AAF53626.1| 4010|Drosophila melanogaster CG5526-PA protein. Length = 4010 Score = 27.9 bits (59), Expect = 2.1 Identities = 11/34 (32%), Positives = 23/34 (67%) Frame = -3 Query: 137 IVPHNSISKSIEMMISFKNNIQHVTGITHILKRP 36 +V +N++SK ++ F+ I+H++ I I+K+P Sbjct: 2267 LVEYNNMSKKPMNLVLFRFAIEHLSRICRIIKQP 2300 >AE014296-910|AAF47948.2| 4390|Drosophila melanogaster CG17150-PA, isoform A protein. Length = 4390 Score = 27.1 bits (57), Expect = 3.6 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = -3 Query: 128 HNSISKSIEMMISFKNNIQHVTGITHILKRPN*NI 24 +NS S + ++ F+ I+HV+ ++ +L+ P NI Sbjct: 2618 YNSFSSTPMDLVMFRFAIEHVSRVSRVLQMPRGNI 2652 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,447,135 Number of Sequences: 53049 Number of extensions: 180672 Number of successful extensions: 278 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 278 length of database: 24,988,368 effective HSP length: 68 effective length of database: 21,381,036 effective search space used: 449001756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -