BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_A20 (289 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 25 0.74 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 24 0.98 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 2.3 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 22 5.2 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 22 5.2 AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 21 6.9 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 21 9.1 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 21 9.1 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 21 9.1 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 24.6 bits (51), Expect = 0.74 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -2 Query: 255 PCTLPPRRGTVRSSSVDESSDTRHESSRGA 166 P + RRGT S++++ ++ + E +RGA Sbjct: 454 PSSTDIRRGTSNSNNINAATGQQQEPARGA 483 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 24.2 bits (50), Expect = 0.98 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 221 GRAQLMKALTQDMSPQGAHRT*TESPPHSQHQQE 120 G+AQ ++ Q PQ + + P SQ QQ+ Sbjct: 398 GQAQPSQSAAQQYQPQQQQQQQQQQQPQSQQQQQ 431 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -3 Query: 206 MKALTQDMSPQGAHRT*TESPPHSQHQQE 120 + L +M PQ HR+ + Q QQ+ Sbjct: 1284 LPGLASEMQPQQLHRSQQQQQQQQQQQQQ 1312 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 21.8 bits (44), Expect = 5.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 246 LPPRRGTVRSSSVDESSDTRHESSRGAPH 160 L P +GT +S E+S T H++S H Sbjct: 594 LTPPKGTFFYASAVENSLTAHQASIATIH 622 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 21.8 bits (44), Expect = 5.2 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 Query: 176 QGAHRT*TESPPHSQHQQEAGGDS 105 +GAH T P Q QQ+ G + Sbjct: 1039 KGAHTTFAPGPCQQQQQQQYAGSN 1062 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = -2 Query: 258 DPCTLPPRRGTVRSSSVDESSDTRHESSRG 169 D PP RS S R+ SSRG Sbjct: 374 DSAKFPPSFRIARSYGSSNRSGLRYRSSRG 403 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 21.0 bits (42), Expect = 9.1 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -2 Query: 270 ARARDPCTLPPRRGTVRSSSVDESSDTRHESSRGAPH 160 A DP + +G +R +VD S + + G P+ Sbjct: 160 ANDNDPLVVNTDKGRIRGITVDAPSGKKVDVWLGIPY 196 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 21.0 bits (42), Expect = 9.1 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -2 Query: 270 ARARDPCTLPPRRGTVRSSSVDESSDTRHESSRGAPH 160 A DP + +G +R +VD S + + G P+ Sbjct: 160 ANDNDPLVVNTDKGRIRGITVDAPSGKKVDVWLGIPY 196 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 21.0 bits (42), Expect = 9.1 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -2 Query: 270 ARARDPCTLPPRRGTVRSSSVDESSDTRHESSRGAPH 160 A DP + +G +R +VD S + + G P+ Sbjct: 46 ANDNDPLVVNTDKGRIRGITVDAPSGKKVDVWLGIPY 82 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 284,364 Number of Sequences: 2352 Number of extensions: 4648 Number of successful extensions: 12 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 17384760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -