BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_A17 (476 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC033786-1|AAH33786.2| 465|Homo sapiens ring finger protein 38 ... 29 6.3 AL354935-3|CAO03541.1| 465|Homo sapiens ring finger protein 38 ... 29 6.3 AL354935-2|CAO03540.1| 515|Homo sapiens ring finger protein 38 ... 29 6.3 AL354935-1|CAH70194.1| 439|Homo sapiens ring finger protein 38 ... 29 6.3 AL161792-4|CAO03554.1| 465|Homo sapiens ring finger protein 38 ... 29 6.3 AL161792-3|CAO03553.1| 515|Homo sapiens ring finger protein 38 ... 29 6.3 AL161792-1|CAI16895.1| 439|Homo sapiens ring finger protein 38 ... 29 6.3 AK024996-1|BAB15050.1| 332|Homo sapiens protein ( Homo sapiens ... 29 6.3 AF394047-1|AAM73697.1| 432|Homo sapiens RING finger protein 38 ... 29 6.3 >BC033786-1|AAH33786.2| 465|Homo sapiens ring finger protein 38 protein. Length = 465 Score = 29.5 bits (63), Expect = 6.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 377 YQFLQPVHPPRHPQFLAPRANALSPLPPRVG 469 Y+ QP+ PP + L P ++ P+PP VG Sbjct: 323 YRSQQPIPPPPYHPSLLPYVLSMLPVPPAVG 353 >AL354935-3|CAO03541.1| 465|Homo sapiens ring finger protein 38 protein. Length = 465 Score = 29.5 bits (63), Expect = 6.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 377 YQFLQPVHPPRHPQFLAPRANALSPLPPRVG 469 Y+ QP+ PP + L P ++ P+PP VG Sbjct: 323 YRSQQPIPPPPYHPSLLPYVLSMLPVPPAVG 353 >AL354935-2|CAO03540.1| 515|Homo sapiens ring finger protein 38 protein. Length = 515 Score = 29.5 bits (63), Expect = 6.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 377 YQFLQPVHPPRHPQFLAPRANALSPLPPRVG 469 Y+ QP+ PP + L P ++ P+PP VG Sbjct: 373 YRSQQPIPPPPYHPSLLPYVLSMLPVPPAVG 403 >AL354935-1|CAH70194.1| 439|Homo sapiens ring finger protein 38 protein. Length = 439 Score = 29.5 bits (63), Expect = 6.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 377 YQFLQPVHPPRHPQFLAPRANALSPLPPRVG 469 Y+ QP+ PP + L P ++ P+PP VG Sbjct: 297 YRSQQPIPPPPYHPSLLPYVLSMLPVPPAVG 327 >AL161792-4|CAO03554.1| 465|Homo sapiens ring finger protein 38 protein. Length = 465 Score = 29.5 bits (63), Expect = 6.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 377 YQFLQPVHPPRHPQFLAPRANALSPLPPRVG 469 Y+ QP+ PP + L P ++ P+PP VG Sbjct: 323 YRSQQPIPPPPYHPSLLPYVLSMLPVPPAVG 353 >AL161792-3|CAO03553.1| 515|Homo sapiens ring finger protein 38 protein. Length = 515 Score = 29.5 bits (63), Expect = 6.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 377 YQFLQPVHPPRHPQFLAPRANALSPLPPRVG 469 Y+ QP+ PP + L P ++ P+PP VG Sbjct: 373 YRSQQPIPPPPYHPSLLPYVLSMLPVPPAVG 403 >AL161792-1|CAI16895.1| 439|Homo sapiens ring finger protein 38 protein. Length = 439 Score = 29.5 bits (63), Expect = 6.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 377 YQFLQPVHPPRHPQFLAPRANALSPLPPRVG 469 Y+ QP+ PP + L P ++ P+PP VG Sbjct: 297 YRSQQPIPPPPYHPSLLPYVLSMLPVPPAVG 327 >AK024996-1|BAB15050.1| 332|Homo sapiens protein ( Homo sapiens cDNA: FLJ21343 fis, clone COL02679. ). Length = 332 Score = 29.5 bits (63), Expect = 6.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 377 YQFLQPVHPPRHPQFLAPRANALSPLPPRVG 469 Y+ QP+ PP + L P ++ P+PP VG Sbjct: 190 YRSQQPIPPPPYHPSLLPYVLSMLPVPPAVG 220 >AF394047-1|AAM73697.1| 432|Homo sapiens RING finger protein 38 protein. Length = 432 Score = 29.5 bits (63), Expect = 6.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 377 YQFLQPVHPPRHPQFLAPRANALSPLPPRVG 469 Y+ QP+ PP + L P ++ P+PP VG Sbjct: 290 YRSQQPIPPPPYHPSLLPYVLSMLPVPPAVG 320 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,478,526 Number of Sequences: 237096 Number of extensions: 1392284 Number of successful extensions: 4008 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3986 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4213781852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -