Samia BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0002_A14
         (389 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A7LVW2 Cluster: Putative uncharacterized protein; n=1; ...    31   7.9  

>UniRef50_A7LVW2 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides ovatus ATCC 8483|Rep: Putative
           uncharacterized protein - Bacteroides ovatus ATCC 8483
          Length = 665

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%)
 Frame = +1

Query: 265 KSDNNLLLNIIS-KHEAYWRVLFHSNTSEDDL 357
           K+DNNLL  II    E YW VL++ N + + L
Sbjct: 87  KNDNNLLCPIIGIDSEGYWTVLYNKNETPERL 118


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 304,022,392
Number of Sequences: 1657284
Number of extensions: 4212636
Number of successful extensions: 7415
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7305
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7414
length of database: 575,637,011
effective HSP length: 91
effective length of database: 424,824,167
effective search space used: 16143318346
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)