BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_A14 (389 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54378| Best HMM Match : Arena_glycoprot (HMM E-Value=0.71) 27 5.4 SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) 26 9.5 >SB_54378| Best HMM Match : Arena_glycoprot (HMM E-Value=0.71) Length = 699 Score = 27.1 bits (57), Expect = 5.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 34 MFSI*VLYIMCFYITTKSVICVYRKLINVRL 126 M+ + V Y++C ++T K V KL +RL Sbjct: 293 MYKVEVFYVLCLFLTGKHKQTVQSKLSELRL 323 >SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) Length = 893 Score = 26.2 bits (55), Expect = 9.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 296 FPNTKRTGASSSTLIPLRMISTRDNRC 376 F NT R S+S IPL+ +S RC Sbjct: 543 FKNTSRFAQSASITIPLKALSYGAERC 569 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,599,937 Number of Sequences: 59808 Number of extensions: 141870 Number of successful extensions: 228 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 227 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 228 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 681761575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -