Samia BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0002_A14
         (389 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC016754-1|AAH16754.1|   76|Homo sapiens KPNA4 protein protein.        29   7.1  

>BC016754-1|AAH16754.1|   76|Homo sapiens KPNA4 protein protein.
          Length = 76

 Score = 28.7 bits (61), Expect = 7.1
 Identities = 11/31 (35%), Positives = 20/31 (64%)
 Frame = +1

Query: 19  SFLF*MFSI*VLYIMCFYITTKSVICVYRKL 111
           +FLF  FS  +LY++C ++    V  ++RK+
Sbjct: 39  AFLFFFFSFYLLYLVCLFLVASQVRKLFRKV 69


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 43,021,665
Number of Sequences: 237096
Number of extensions: 609902
Number of successful extensions: 639
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 639
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 639
length of database: 76,859,062
effective HSP length: 82
effective length of database: 57,417,190
effective search space used: 2698607930
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)