BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_A10 (243 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-11 SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) 64 2e-11 SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 64 2e-11 SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) 64 2e-11 SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 64 2e-11 SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) 64 2e-11 SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) 64 2e-11 SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) 64 2e-11 SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) 64 2e-11 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 64 2e-11 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) 64 2e-11 SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) 64 2e-11 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-11 SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) 64 2e-11 SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) 64 2e-11 SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) 64 2e-11 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-11 SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-10 SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 55 8e-09 SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-09 SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-07 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.004 SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.005 SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.005 SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.005 SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.005 SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.005 SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) 34 0.020 SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.11 SB_41723| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.25 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.33 SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.44 SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_23055| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) 26 4.1 SB_22899| Best HMM Match : Glyco_transf_8 (HMM E-Value=9.5e-15) 26 4.1 SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.4 SB_37884| Best HMM Match : Ubie_methyltran (HMM E-Value=0.00014) 26 5.4 SB_36007| Best HMM Match : Collagen (HMM E-Value=9e-25) 26 5.4 SB_13146| Best HMM Match : Laminin_G_2 (HMM E-Value=1.5e-25) 26 5.4 SB_18457| Best HMM Match : GPW_gp25 (HMM E-Value=2.7) 26 5.4 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.2 SB_25350| Best HMM Match : Collagen (HMM E-Value=0) 25 7.2 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.2 SB_49216| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.2 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.2 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.2 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.2 SB_41816| Best HMM Match : Peptidase_M10 (HMM E-Value=0) 25 7.2 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.2 SB_17317| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.2 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.2 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.2 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 25 9.5 SB_47335| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 >SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 64.5 bits (150), Expect = 1e-11 Identities = 37/72 (51%), Positives = 39/72 (54%) Frame = +2 Query: 26 MSWAARALH*RNQHVLPGLEARATR*NSFVLGIGVCNYPP*DEEFLVSASHKLALITSLP 205 M W Q V P E G C +EEFLVSASH+LALITSLP Sbjct: 1 MFWGRTRATLTGQRVFPSPEGGGNLVKHRRAGDRSCKLLIFNEEFLVSASHQLALITSLP 60 Query: 206 FVHTARRYYRLN 241 FVHTARRYYRLN Sbjct: 61 FVHTARRYYRLN 72 >SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 89 NEEFLVSASHQLALITSLPFVHTARRYYRLN 119 >SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 161 NEEFLVSASHQLALITSLPFVHTARRYYRLN 191 Score = 25.4 bits (53), Expect = 7.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 43 RATLKESACSPWPRGPGNPLKLLRAGDWGLQL 138 R +++ C+ G GN +K RAGD LQL Sbjct: 126 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQL 157 >SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 45 NEEFLVSASHQLALITSLPFVHTARRYYRLN 75 Score = 42.3 bits (95), Expect = 6e-05 Identities = 23/41 (56%), Positives = 26/41 (63%) Frame = +1 Query: 16 MPLDVLGRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQL 138 MPLDVLGRTRATL S + G GN +K RAGD +L Sbjct: 1 MPLDVLGRTRATLTVSTSLSFAGGVGNLVKHRRAGDRSCKL 41 >SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) Length = 101 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 46 NEEFLVSASHQLALITSLPFVHTARRYYRLN 76 Score = 30.7 bits (66), Expect = 0.19 Identities = 21/42 (50%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 16 MPLDVLGR-TRATLKESACSPWPRGPGNPLKLLRAGDWGLQL 138 MPLDVLGR R T + +G GN +K RAGD LQL Sbjct: 1 MPLDVLGRHARYTDGVNESFLRRKGVGNLVKHRRAGDRSLQL 42 >SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 108 NEEFLVSASHQLALITSLPFVHTARRYYRLN 138 Score = 25.4 bits (53), Expect = 7.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 43 RATLKESACSPWPRGPGNPLKLLRAGDWGLQL 138 R +++ C+ G GN +K RAGD LQL Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQL 104 >SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 43 NEEFLVSASHQLALITSLPFVHTARRYYRLN 73 Score = 29.1 bits (62), Expect = 0.58 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +3 Query: 27 CPGPHARYTEGIS 65 C GPHARYT+G++ Sbjct: 2 CSGPHARYTDGVN 14 >SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 46 NEEFLVSASHQLALITSLPFVHTARRYYRLN 76 Score = 39.9 bits (89), Expect = 3e-04 Identities = 24/42 (57%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +1 Query: 16 MPLDVLGRTRATLKESACSPWPR-GPGNPLKLLRAGDWGLQL 138 MPLDVLGR R TL S + R G GN +K RAGD LQL Sbjct: 1 MPLDVLGRPRVTLTVSTSLSFRRKGVGNLVKHRRAGDRSLQL 42 >SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) Length = 186 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 22 NEEFLVSASHQLALITSLPFVHTARRYYRLN 52 >SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 36 NEEFLVSASHQLALITSLPFVHTARRYYRLN 66 >SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 22 NEEFLVSASHQLALITSLPFVHTARRYYRLN 52 >SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 46 NEEFLVSASHQLALITSLPFVHTARRYYRLN 76 Score = 39.9 bits (89), Expect = 3e-04 Identities = 24/42 (57%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +1 Query: 16 MPLDVLGRTRA-TLKESACSPWPRGPGNPLKLLRAGDWGLQL 138 MPLDVLGRTR T + P P G GN +K RAGD LQL Sbjct: 1 MPLDVLGRTRRYTDGVNESFPRPEGVGNLVKHRRAGDRSLQL 42 >SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 46 NEEFLVSASHQLALITSLPFVHTARRYYRLN 76 Score = 44.4 bits (100), Expect = 1e-05 Identities = 26/42 (61%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +1 Query: 16 MPLDVLGRTRATLKESACSPWPR-GPGNPLKLLRAGDWGLQL 138 MPLDVLGRTRATL S + R G GN +K RAGD LQL Sbjct: 1 MPLDVLGRTRATLTVSTSLSFARKGVGNLVKHRRAGDRSLQL 42 >SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 43 NEEFLVSASHQLALITSLPFVHTARRYYRLN 73 Score = 29.1 bits (62), Expect = 0.58 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +3 Query: 27 CPGPHARYTEGIS 65 C GPHARYT+G++ Sbjct: 2 CSGPHARYTDGVN 14 >SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 200 NEEFLVSASHQLALITSLPFVHTARRYYRLN 230 Score = 26.2 bits (55), Expect = 4.1 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 43 RATLKESACSPWPRGPGNPLKLLRAGDWGLQL 138 R +++ C+ G GN +K RAGD LQL Sbjct: 165 RKVTRKATCARCFAGVGNLVKYRRAGDRSLQL 196 >SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 108 NEEFLVSASHQLALITSLPFVHTARRYYRLN 138 >SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) Length = 91 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 36 NEEFLVSASHQLALITSLPFVHTARRYYRLN 66 >SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 8 NEEFLVSASHQLALITSLPFVHTARRYYRLN 38 >SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 156 NEEFLVSASHQLALITSLPFVHTARRYYRLN 186 Score = 26.6 bits (56), Expect = 3.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 43 RATLKESACSPWPRGPGNPLKLLRAGDWGLQL 138 R ++++ C+ G GN +K RAGD LQL Sbjct: 121 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQL 152 >SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 22 NEEFLVSASHQLALITSLPFVHTARRYYRLN 52 >SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 45 NEEFLVSASHQLALITSLPFVHTARRYYRLN 75 Score = 48.4 bits (110), Expect = 9e-07 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = +1 Query: 16 MPLDVLGRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQL 138 MPLDVL RTRATL S P P G GN +K RAGD LQL Sbjct: 1 MPLDVLDRTRATLTVSRVFPSPEGVGNLVKHRRAGDRSLQL 41 >SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 156 NEEFLVSASHQLALITSLPFVHTARRYYRLN 186 Score = 26.6 bits (56), Expect = 3.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 43 RATLKESACSPWPRGPGNPLKLLRAGDWGLQL 138 R ++++ C+ G GN +K RAGD LQL Sbjct: 121 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQL 152 >SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 108 NEEFLVSASHQLALITSLPFVHTARRYYRLN 138 Score = 26.2 bits (55), Expect = 4.1 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 43 RATLKESACSPWPRGPGNPLKLLRAGDWGLQL 138 R +++ C+ G GN +K RAGD LQL Sbjct: 73 RKVTRKATCARCFAGVGNLVKYRRAGDRSLQL 104 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 97 NEEFLVSASHQLALITSLPFVHTARRYYRLN 127 >SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 22 NEEFLVSASHQLALITSLPFVHTARRYYRLN 52 >SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 43 NEEFLVSASHQLALITSLPFVHTARRYYRLN 73 Score = 29.1 bits (62), Expect = 0.58 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +3 Query: 27 CPGPHARYTEGIS 65 C GPHARYT+G++ Sbjct: 2 CSGPHARYTDGVN 14 >SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 137 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 82 NEEFLVSASHQLALITSLPFVHTARRYYRLN 112 Score = 25.4 bits (53), Expect = 7.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 43 RATLKESACSPWPRGPGNPLKLLRAGDWGLQL 138 R +++ C+ G GN +K RAGD LQL Sbjct: 47 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQL 78 >SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) Length = 214 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 159 NEEFLVSASHQLALITSLPFVHTARRYYRLN 189 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 125 NEEFLVSASHQLALITSLPFVHTARRYYRLN 155 Score = 25.4 bits (53), Expect = 7.2 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 79 PRGPGNPLKLLRAGDWGLQL 138 P+G GN +K RAGD LQL Sbjct: 102 PQGVGNLVKHRRAGDRSLQL 121 >SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) Length = 216 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 161 NEEFLVSASHQLALITSLPFVHTARRYYRLN 191 Score = 26.6 bits (56), Expect = 3.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 43 RATLKESACSPWPRGPGNPLKLLRAGDWGLQL 138 R ++++ C+ G GN +K RAGD LQL Sbjct: 126 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQL 157 >SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 108 NEEFLVSASHQLALITSLPFVHTARRYYRLN 138 Score = 25.4 bits (53), Expect = 7.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 43 RATLKESACSPWPRGPGNPLKLLRAGDWGLQL 138 R +++ C+ G GN +K RAGD LQL Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQL 104 >SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) Length = 101 Score = 63.7 bits (148), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTARRYYRLN Sbjct: 22 NEEFLVSASHQLALITSLPFVHTARRYYRLN 52 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 62.5 bits (145), Expect = 5e-11 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSA+H+LALITSLPFVHTARRYYRLN Sbjct: 65 NEEFLVSANHQLALITSLPFVHTARRYYRLN 95 Score = 25.4 bits (53), Expect = 7.2 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 79 PRGPGNPLKLLRAGDWGLQL 138 P+G GN +K RAGD LQL Sbjct: 42 PQGVGNLVKHRRAGDRSLQL 61 >SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 60.9 bits (141), Expect = 2e-10 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 149 DEEFLVSASHKLALITSLPFVHTARRYYRLN 241 +EEFLVSASH+LALITSLPFVHTAR YYRLN Sbjct: 108 NEEFLVSASHQLALITSLPFVHTARGYYRLN 138 Score = 25.4 bits (53), Expect = 7.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 43 RATLKESACSPWPRGPGNPLKLLRAGDWGLQL 138 R +++ C+ G GN +K RAGD LQL Sbjct: 73 RKVTRKATCARCFAGVGNLVKHRRAGDRSLQL 104 >SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 40 VSASHQLALITSLPFVHTARRYYRLN 65 Score = 25.8 bits (54), Expect = 5.4 Identities = 8/11 (72%), Positives = 11/11 (100%) Frame = +3 Query: 33 GPHARYTEGIS 65 GPHARYT+G++ Sbjct: 7 GPHARYTDGVN 17 >SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 167 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 15 VSASHQLALITSLPFVHTARRYYRLN 40 >SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 92 VSASHQLALITSLPFVHTARRYYRLN 117 >SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 55.2 bits (127), Expect = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 164 VSASHKLALITSLPFVHTARRYYRLN 241 VSASH+LALITSLPFVHTARRYYRLN Sbjct: 14 VSASHQLALITSLPFVHTARRYYRLN 39 >SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 50.0 bits (114), Expect = 3e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -2 Query: 242 HSIGSSDGRCVQRAGR*STRAYDSRLLGIPR 150 HSIGSSDGRCVQRAG S D RLLGIPR Sbjct: 37 HSIGSSDGRCVQRAGTQSMHIDDMRLLGIPR 67 >SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 36.3 bits (80), Expect = 0.004 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 242 HSIGSSDGRCVQRAG 198 HSIGSSDGRCVQRAG Sbjct: 28 HSIGSSDGRCVQRAG 42 >SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 35.9 bits (79), Expect = 0.005 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 62 DSFSVARVRPRTSKGITD 9 D+ SVARVRPRTSKGITD Sbjct: 34 DTVSVARVRPRTSKGITD 51 >SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 35.9 bits (79), Expect = 0.005 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 62 DSFSVARVRPRTSKGITD 9 D+ SVARVRPRTSKGITD Sbjct: 132 DTVSVARVRPRTSKGITD 149 >SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 35.9 bits (79), Expect = 0.005 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 62 DSFSVARVRPRTSKGITD 9 D+ SVARVRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 35.9 bits (79), Expect = 0.005 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 62 DSFSVARVRPRTSKGITD 9 D+ SVARVRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 35.9 bits (79), Expect = 0.005 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 62 DSFSVARVRPRTSKGITD 9 D+ SVARVRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) Length = 86 Score = 33.9 bits (74), Expect = 0.020 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 62 DSFSVARVRPRTSKGITD 9 D+ SVA VRPRTSKGITD Sbjct: 64 DTVSVAHVRPRTSKGITD 81 >SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 31.5 bits (68), Expect = 0.11 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 62 DSFSVARVRPRTSKGITD 9 D+ SVARVR +TSKGITD Sbjct: 64 DTVSVARVRAKTSKGITD 81 >SB_41723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 30.3 bits (65), Expect = 0.25 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 16 MPLDVLGRTRATLKES 63 MPLDVLGRTRATL S Sbjct: 1 MPLDVLGRTRATLTVS 16 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 29.9 bits (64), Expect = 0.33 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 16 MPLDVLGRTRATL 54 MPLDVLGRTRATL Sbjct: 1 MPLDVLGRTRATL 13 >SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1271 Score = 29.5 bits (63), Expect = 0.44 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 Query: 167 LLGIPRPMGDNCKPQSPARRSFNGLPGPLG 78 L+G P+G P SP R G+PGP+G Sbjct: 1026 LMGRSGPVGPPGPPGSPGDRGQTGVPGPVG 1055 >SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1705 Score = 28.7 bits (61), Expect = 0.77 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -2 Query: 167 LLGIPRPMGDNCKPQSPARRSFNGLPGPLGQG 72 L G P P G N +P P G PGP+ G Sbjct: 898 LAGSPGPRGPNGEPGDPGMDGDKGPPGPVDAG 929 Score = 25.0 bits (52), Expect = 9.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 143 GDNCKPQSPARRSFNGLPGPLG 78 G + +P P NGLPGP G Sbjct: 876 GSDGRPGFPGESGANGLPGPPG 897 >SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1853 Score = 27.9 bits (59), Expect = 1.3 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = -2 Query: 167 LLGIPRPMGDNCKPQSPARRSFNGLPGPLGQ 75 L GIP P GD P P R GLPGP+G+ Sbjct: 993 LPGIPGPKGDT-GPVGPPGRP--GLPGPVGK 1020 >SB_23055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 26.6 bits (56), Expect = 3.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -2 Query: 167 LLGIPRPMGDNCKPQSPARRSFNGLPGPLGQ-GEHADSFSVARVRPRTSKGITDP 6 L GIP G P P +R G PG G+ G H + PR G P Sbjct: 150 LNGIPGVSGKQGPPGPPGKRGRRGHPGEPGRNGTHGSPGWRGKTGPRGPMGPIGP 204 >SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) Length = 792 Score = 26.2 bits (55), Expect = 4.1 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -2 Query: 146 MGDNCKPQSPARRSFNGLPGPLGQGEHADSFSVARVRPR 30 MG PQ P + + G+PGP G G A + + A R Sbjct: 307 MGPRGSPQGPPQVT-PGMPGPAGMGAAAAAAAAAMAAAR 344 >SB_22899| Best HMM Match : Glyco_transf_8 (HMM E-Value=9.5e-15) Length = 847 Score = 26.2 bits (55), Expect = 4.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 155 PRPMGDNCKPQSPARRSFNG 96 P+P ++C+P S + FNG Sbjct: 368 PKPWKEHCRPSSKEAKKFNG 387 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 25.8 bits (54), Expect = 5.4 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -2 Query: 155 PRPMGDNCKPQSPARRSFNGLPGPLGQGEHADSF 54 P P+G N KP+ RRS GL PL G + F Sbjct: 1169 PSPIGCN-KPRDCVRRSPIGLNKPLEPGSYDTGF 1201 >SB_37884| Best HMM Match : Ubie_methyltran (HMM E-Value=0.00014) Length = 399 Score = 25.8 bits (54), Expect = 5.4 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -2 Query: 128 PQSPARRSFNGLPGPLGQGEHADSFSVARVRPRTSKG 18 P + SF GL P G+ H + ++P S G Sbjct: 30 PSTTTLYSFKGLANPTGKDMHPTKVLASTLKPNNSTG 66 >SB_36007| Best HMM Match : Collagen (HMM E-Value=9e-25) Length = 311 Score = 25.8 bits (54), Expect = 5.4 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = -2 Query: 149 PMGDNCKPQSPARRSFNGLPGPLGQGEHADSFSVARVRPRTSKGITDP 6 P GD+ +P R+ G PG G+ + RP +KG P Sbjct: 137 PKGDSGRPGQDGRQGPPGPPGARGEPGQQAPMMIQVSRPGPNKGPPGP 184 >SB_13146| Best HMM Match : Laminin_G_2 (HMM E-Value=1.5e-25) Length = 614 Score = 25.8 bits (54), Expect = 5.4 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 27 CPGPHARYTEGISMFSLA*RPGQPVETPS 113 CP H +YT G FS PG PV P+ Sbjct: 241 CPSRHIKYTMGGEFFS----PGFPVAYPA 265 >SB_18457| Best HMM Match : GPW_gp25 (HMM E-Value=2.7) Length = 577 Score = 25.8 bits (54), Expect = 5.4 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 176 DSRLLGIPRPMGDNCKPQSPARRSFNGL 93 ++R+ +PRP D+C +S FNG+ Sbjct: 285 EARVGDMPRPYSDSCLLRSVVDEDFNGV 312 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 30 PGPHARYTEGISMFSLA*RPGQPV 101 PGP +R T IS+ S + PG P+ Sbjct: 21 PGPPSRSTVSISLISNSCSPGDPL 44 >SB_25350| Best HMM Match : Collagen (HMM E-Value=0) Length = 1112 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -2 Query: 161 GIPRPMGDNCKPQSPARRSFNGLPGPLG 78 GIP G+ P P + G PGP G Sbjct: 798 GIPGLKGERGSPGEPGKAGKQGPPGPSG 825 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 30 PGPHARYTEGISMFSLA*RPGQPV 101 PGP +R T IS+ S + PG P+ Sbjct: 21 PGPPSRSTVSISLISNSCSPGDPL 44 >SB_49216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 773 Score = 25.4 bits (53), Expect = 7.2 Identities = 8/18 (44%), Positives = 16/18 (88%) Frame = -1 Query: 117 STKEFQRVARASRPGRTC 64 S++EF+R+ ++SRP ++C Sbjct: 441 SSQEFERIHKSSRPPQSC 458 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 30 PGPHARYTEGISMFSLA*RPGQPV 101 PGP +R T IS+ S + PG P+ Sbjct: 21 PGPPSRSTVSISLISNSCSPGDPL 44 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 30 PGPHARYTEGISMFSLA*RPGQPV 101 PGP +R T IS+ S + PG P+ Sbjct: 21 PGPPSRSTVSISLISNSCSPGDPL 44 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 30 PGPHARYTEGISMFSLA*RPGQPV 101 PGP +R T IS+ S + PG P+ Sbjct: 21 PGPPSRSTVSISLISNSCSPGDPL 44 >SB_41816| Best HMM Match : Peptidase_M10 (HMM E-Value=0) Length = 556 Score = 25.4 bits (53), Expect = 7.2 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 128 PQSPARRSFNGLPGPLGQGEHADSFSVA 45 P P R S GLPG + + +DSFS+A Sbjct: 374 PDYPKRISNWGLPGKVDELAPSDSFSLA 401 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 30 PGPHARYTEGISMFSLA*RPGQPV 101 PGP +R T IS+ S + PG P+ Sbjct: 21 PGPPSRSTVSISLISNSCSPGDPL 44 >SB_17317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 25.4 bits (53), Expect = 7.2 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 167 LLGIPRPMGDNCKPQSPARRSFNGLPGPLG-QGEHAD 60 L G+ P G N +P GLPG G QG+ D Sbjct: 310 LRGVTGPDGSNGQPGRQGEPGKQGLPGESGAQGDSGD 346 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 30 PGPHARYTEGISMFSLA*RPGQPV 101 PGP +R T IS+ S + PG P+ Sbjct: 21 PGPPSRSTVSISLISNSCSPGDPL 44 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 30 PGPHARYTEGISMFSLA*RPGQPV 101 PGP +R T IS+ S + PG P+ Sbjct: 19 PGPPSRSTVSISLISNSCSPGDPL 42 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 25.0 bits (52), Expect = 9.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 161 GIPRPMGDNCKPQSPARRSFNGLPGPLG 78 G+P P G P P GLPGP G Sbjct: 177 GLPGPNGPLGPPGPPGDMGPPGLPGPQG 204 >SB_47335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +1 Query: 88 PGNPLKLLRAGDWGLQLSPIGRGIPSKRES 177 P +K+L GDW + GRG+ ++ + Sbjct: 37 PTKHVKILARGDWSTCSASCGRGVQTRNNT 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,936,847 Number of Sequences: 59808 Number of extensions: 193209 Number of successful extensions: 825 Number of sequences better than 10.0: 108 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 819 length of database: 16,821,457 effective HSP length: 58 effective length of database: 13,352,593 effective search space used: 293757046 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -