BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_A06 (380 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding pr... 28 0.043 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 1.6 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 3.7 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 21 4.9 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 20 8.5 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 20 8.5 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 20 8.5 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 20 8.5 >AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding protein protein. Length = 135 Score = 27.9 bits (59), Expect = 0.043 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 35 KGVTVKNETQVSNLMALVKMNEVSAKELLV 124 +G T K ETQV++ + + ++ E S ELLV Sbjct: 88 EGNTFKTETQVNDSLKVTRLYEFSDNELLV 117 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.6 bits (46), Expect = 1.6 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 312 LKTGREWRQHLELTSST 262 + TG++WR H +L + T Sbjct: 128 ISTGQKWRNHRKLIAPT 144 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.4 bits (43), Expect = 3.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 262 ETLDLSIILNTLHHPQEKK*NKKY 191 ETL + + +H PQ K N+ + Sbjct: 350 ETLQTVVAMKMMHLPQSNKMNRMH 373 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 329 LPAPANLKQD 300 LPAPAN K+D Sbjct: 392 LPAPANWKKD 401 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 20.2 bits (40), Expect = 8.5 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 121 GMSDNSDNNFRIDYFVIIN 177 G S D N +DYF IN Sbjct: 299 GPSSVIDTNTGVDYFTQIN 317 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.2 bits (40), Expect = 8.5 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +1 Query: 130 DNSDNNFRIDYFVIINV 180 +N +NN++ Y+ IIN+ Sbjct: 325 NNYNNNYKPLYYNIINI 341 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 20.2 bits (40), Expect = 8.5 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = +1 Query: 127 SDNSDNNFRIDYFVIINV 180 ++N+ NN++ Y+ IIN+ Sbjct: 342 NNNNYNNYKKLYYNIINI 359 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 20.2 bits (40), Expect = 8.5 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = +3 Query: 153 NRLFRYNKCNKVIYFLFYFFS 215 N + YN NK +Y+ Y + Sbjct: 328 NYKYNYNNYNKKLYYKNYIIN 348 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,058 Number of Sequences: 438 Number of extensions: 1728 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9300375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -