BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_A02 (401 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 25 0.78 AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 22 7.3 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 22 7.3 AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 22 9.6 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 25.4 bits (53), Expect = 0.78 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = +3 Query: 45 DDVCLTTQSQTKGE*YELLEVAWYTSMLRNLRRSRGVVSARVNYAVSSPRGP 200 D C T S+ K V W+TS++ +LRR S A +P P Sbjct: 258 DKACDATMSRLKKT-CRWRGVYWWTSVIADLRRKSKAASRVAQRAYDTPEFP 308 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 22.2 bits (45), Expect = 7.3 Identities = 5/8 (62%), Positives = 8/8 (100%) Frame = -1 Query: 371 PFCQTLCW 348 P+C+T+CW Sbjct: 267 PWCRTMCW 274 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 22.2 bits (45), Expect = 7.3 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +2 Query: 242 RVYGGVLCHKCVKQ 283 ++Y GVL KC+K+ Sbjct: 290 QIYMGVLTQKCIKE 303 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 21.8 bits (44), Expect = 9.6 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -2 Query: 331 DFHDLLFFDQESSDDALLHAFVTEN 257 +FH LF + D L + F TEN Sbjct: 44 NFHAELFRTMDEVKDGLRYIFQTEN 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 403,020 Number of Sequences: 2352 Number of extensions: 7453 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32067225 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -