BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_A02 (401 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g26880.1 68414.m03278 60S ribosomal protein L34 (RPL34A) iden... 119 6e-28 At1g69620.1 68414.m08008 60S ribosomal protein L34 (RPL34B) simi... 117 3e-27 At3g28900.1 68416.m03607 60S ribosomal protein L34 (RPL34C) simi... 116 4e-27 At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transfera... 28 2.7 At1g63240.1 68414.m07148 expressed protein 28 2.7 At1g48740.1 68414.m05454 expressed protein 28 2.7 At2g17830.1 68415.m02065 F-box family protein contains Pfam doma... 27 3.5 At3g52920.2 68416.m05833 expressed protein weak similarity to en... 27 4.7 At3g52920.1 68416.m05832 expressed protein weak similarity to en... 27 4.7 At3g20710.1 68416.m02621 F-box protein-related contains weak hit... 27 4.7 At1g33410.1 68414.m04136 expressed protein 27 4.7 At2g36780.1 68415.m04511 UDP-glucoronosyl/UDP-glucosyl transfera... 27 6.2 At2g36770.1 68415.m04510 UDP-glucoronosyl/UDP-glucosyl transfera... 26 8.2 At2g36750.1 68415.m04508 UDP-glucoronosyl/UDP-glucosyl transfera... 26 8.2 At1g32585.1 68414.m04021 VQ motif-containing protein-related con... 26 8.2 >At1g26880.1 68414.m03278 60S ribosomal protein L34 (RPL34A) identical to GB:Q42351, location of EST 105E2T7, gb|T22624 Length = 120 Score = 119 bits (287), Expect = 6e-28 Identities = 60/104 (57%), Positives = 74/104 (71%), Gaps = 2/104 (1%) Frame = +2 Query: 23 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 202 MVQRL +R R SY TKSNQ RIV+TPGG+LVYQ KK P+C +++GI RP+ Sbjct: 1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPS 60 Query: 203 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 328 E RSRL ++TV R YGGVL V++RI+RAFL+EEQKIVK Sbjct: 61 EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAFLVEEQKIVK 104 >At1g69620.1 68414.m08008 60S ribosomal protein L34 (RPL34B) similar to SP:Q42351 from [Arabidopsis thaliana] Length = 119 Score = 117 bits (282), Expect = 3e-27 Identities = 59/104 (56%), Positives = 72/104 (69%), Gaps = 2/104 (1%) Frame = +2 Query: 23 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 202 MVQRL +R R SY TKSNQ RIV+TPGG+L YQ KK P+C +++GI RP Sbjct: 1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPT 60 Query: 203 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 328 E RSRL ++TV R YGGVL V++RI+RAFL+EEQKIVK Sbjct: 61 EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAFLVEEQKIVK 104 >At3g28900.1 68416.m03607 60S ribosomal protein L34 (RPL34C) similar to 60S ribosomal protein L34 GB:P41098 [Nicotiana tabacum] Length = 120 Score = 116 bits (280), Expect = 4e-27 Identities = 60/104 (57%), Positives = 72/104 (69%), Gaps = 2/104 (1%) Frame = +2 Query: 23 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 202 MVQRL +R R SY TKSNQ RIV+TPGG+L YQ K P+C +++GI RPA Sbjct: 1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTNKRASGPKCPVTGKRIQGIPHLRPA 60 Query: 203 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 328 E RSRL ++TV R YGGVL V++RIVRAFL+EEQKIVK Sbjct: 61 EYKRSRLARNERTVNRAYGGVLSGVAVRERIVRAFLVEEQKIVK 104 >At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 27.9 bits (59), Expect = 2.7 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -3 Query: 213 RERSAGLAGWIPRSLLLH*PHLGIFLGFLTY 121 +ERS + GW P+ L+L P +G GFLT+ Sbjct: 347 KERSLLIKGWSPQMLILSHPAVG---GFLTH 374 >At1g63240.1 68414.m07148 expressed protein Length = 548 Score = 27.9 bits (59), Expect = 2.7 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Frame = +2 Query: 5 EAKSYKMVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGI 184 EA S+ ++ + R S SN + TP + + K+ K RC K +GI Sbjct: 354 EAPSHSVLVFESSNARPSVEDLSNTIELGLTPQEKNISSSKKRKKNTERCASKNIKKKGI 413 Query: 185 Q-PARPAERSR 214 + P+R +R + Sbjct: 414 EAPSRKLQRGK 424 >At1g48740.1 68414.m05454 expressed protein Length = 393 Score = 27.9 bits (59), Expect = 2.7 Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +2 Query: 38 TFRRRLSYNTKSNQRRIVRTP-GGRLVYQ 121 +FR+ +S NTK + RRI+ P G LV+Q Sbjct: 130 SFRKAISENTKESFRRIISEPFPGVLVFQ 158 >At2g17830.1 68415.m02065 F-box family protein contains Pfam domain, PF00646: F-box domain Length = 394 Score = 27.5 bits (58), Expect = 3.5 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 165 LH*PHLGIFLGFLTYWYTKRPPGVRTILLWFDF 67 +H H G+ + TYWY G L+ FDF Sbjct: 208 IHSYHRGLSVKGNTYWYATEKHGYVNFLICFDF 240 >At3g52920.2 68416.m05833 expressed protein weak similarity to enterophilin-2L [Cavia porcellus] GI:12718845; contains Pfam profile PF04949: Family of unknown function (DUF662) Length = 177 Score = 27.1 bits (57), Expect = 4.7 Identities = 21/65 (32%), Positives = 32/65 (49%) Frame = +1 Query: 157 SVQE*TTRYPAREARRAFSSLLPQEDSEARLWRCSLSQMREAAHRQSFLDRRTEDRESPK 336 + E TT+ P + +FSS + +ED E + R +LS R A R+ E RE K Sbjct: 3 TTNEATTQPPQQMMSLSFSSQMSKEDEE--MARSALSAFR--AKEDEIEKRKMEVRERVK 58 Query: 337 SATGQ 351 + G+ Sbjct: 59 AQLGR 63 >At3g52920.1 68416.m05832 expressed protein weak similarity to enterophilin-2L [Cavia porcellus] GI:12718845; contains Pfam profile PF04949: Family of unknown function (DUF662) Length = 180 Score = 27.1 bits (57), Expect = 4.7 Identities = 21/65 (32%), Positives = 32/65 (49%) Frame = +1 Query: 157 SVQE*TTRYPAREARRAFSSLLPQEDSEARLWRCSLSQMREAAHRQSFLDRRTEDRESPK 336 + E TT+ P + +FSS + +ED E + R +LS R A R+ E RE K Sbjct: 3 TTNEATTQPPQQMMSLSFSSQMSKEDEE--MARSALSAFR--AKEDEIEKRKMEVRERVK 58 Query: 337 SATGQ 351 + G+ Sbjct: 59 AQLGR 63 >At3g20710.1 68416.m02621 F-box protein-related contains weak hit to TIGRFAM TIGR01640 : F-box protein interaction domain; contains weak hit to Pfam PF00646: F-box domain Length = 362 Score = 27.1 bits (57), Expect = 4.7 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -3 Query: 147 GIFLGFLTYWYTKRPPGVRTILLWFDF 67 G+ L TYWY K + LL FDF Sbjct: 197 GVSLNGDTYWYAKDKESIDWYLLCFDF 223 >At1g33410.1 68414.m04136 expressed protein Length = 1459 Score = 27.1 bits (57), Expect = 4.7 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 160 VQE*TTRYPAREARRAFSSLLPQED 234 V E TTRYP ++ARRA L D Sbjct: 1145 VPEETTRYPVKKARRAEEEQLRSND 1169 >At2g36780.1 68415.m04511 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 26.6 bits (56), Expect = 6.2 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 213 RERSAGLAGWIPRSLLLH*PHLGIFLGFLTY 121 +ER + GW P+ L+L P +G GFLT+ Sbjct: 347 KERGLLIKGWAPQVLILSHPSVG---GFLTH 374 >At2g36770.1 68415.m04510 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 26.2 bits (55), Expect = 8.2 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 213 RERSAGLAGWIPRSLLLH*PHLGIFLGFLTY 121 +ER + GW P+ L+L P +G GFLT+ Sbjct: 347 KERGLLIKGWSPQVLILSHPSVG---GFLTH 374 >At2g36750.1 68415.m04508 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 491 Score = 26.2 bits (55), Expect = 8.2 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 213 RERSAGLAGWIPRSLLLH*PHLGIFLGFLTY 121 +ER + GW P+ L+L P +G GFLT+ Sbjct: 342 KERGLLITGWSPQMLILTHPAVG---GFLTH 369 >At1g32585.1 68414.m04021 VQ motif-containing protein-related contains weak similarity to Pfma:PF05678 VQ motif Length = 220 Score = 26.2 bits (55), Expect = 8.2 Identities = 13/54 (24%), Positives = 22/54 (40%) Frame = +3 Query: 63 TQSQTKGE*YELLEVAWYTSMLRNLRRSRGVVSARVNYAVSSPRGPQSVLVSAT 224 TQS + +E +W+ + + + + S RV+Y P P S T Sbjct: 142 TQSMPQSNGFEPFPSSWFNGSTQEMHGASSLQSTRVDYEYPLPLTPNFTFSSMT 195 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,404,879 Number of Sequences: 28952 Number of extensions: 153162 Number of successful extensions: 499 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 496 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 585758608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -