BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_A01 (455 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 4.1 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 5.5 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 4.1 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +3 Query: 270 TRTVLLKSRKSFYPTQ----DKIRGRSHGKSFSKHVRRTRPNLTPG 395 TRT L +R S YP Q + H + H+++ P PG Sbjct: 256 TRTTLKNNRASPYPMQRPKSASLSPPPHVYNPPDHIQQATPYSAPG 301 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.0 bits (42), Expect = 5.5 Identities = 9/19 (47%), Positives = 11/19 (57%), Gaps = 1/19 (5%) Frame = -3 Query: 75 AGCGCGGFLRHLGLW-WSP 22 A C G +RH G W +SP Sbjct: 62 AAYDCEGVIRHHGQWNYSP 80 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,566 Number of Sequences: 336 Number of extensions: 2249 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10406187 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -