BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_A01 (455 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 6.7 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 22 8.9 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 22.6 bits (46), Expect = 6.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 327 RGRSHGKSFSKHVRRTRPNLTPGTVCILLAGRHAGKRVVL 446 + RS K + ++RT L P LLAG H+ ++VL Sbjct: 3 QNRSTDKLQMEILKRTVCRLKPSAHRCLLAGSHSFTQLVL 42 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 22.2 bits (45), Expect = 8.9 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 3/24 (12%) Frame = +3 Query: 354 SKHVRRT---RPNLTPGTVCILLA 416 S+ ++RT P LTP T+C L+A Sbjct: 453 SRVIQRTPSSSPPLTPNTICGLIA 476 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 500,483 Number of Sequences: 2352 Number of extensions: 9361 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39119412 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -