BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_P24 (589 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein ... 26 1.0 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 25 2.4 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 25 2.4 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 9.7 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 23 9.7 >AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein S17 protein. Length = 131 Score = 25.8 bits (54), Expect = 1.0 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +2 Query: 185 HSIMRSASIKKRKEIFKRAEQYVKEYRIKERDEIRL 292 HS +R SIK ++E +R + YV + E+D I + Sbjct: 63 HSQVRGISIKLQEEERERRDNYVPDVSALEQDIIEV 98 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 24.6 bits (51), Expect = 2.4 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +3 Query: 405 CSCSGCVRSTTACSFVSTRPQ*TCFVSLSPILHGAT 512 C C G TRP +CFVS+ +L T Sbjct: 74 CYCEGHCPGNLQNGTCETRPGGSCFVSVEAVLDEET 109 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 24.6 bits (51), Expect = 2.4 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +2 Query: 191 IMRSASIKKRKEIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAK 343 I S ++ E+F+++ Q +E+ I D I L QAR Y P E++ Sbjct: 244 IFDSTHVQFFTEMFRQSVQEREEHGIVRPDLIHLLIQARKGQLRYQPQESE 294 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 22.6 bits (46), Expect = 9.7 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -1 Query: 586 DRDTLPVQFGETAFVHQLSDTLQVGVAPCNIGLSD 482 + D P +F + + H +++ Q GVA C + D Sbjct: 949 ENDNNP-KFRKPFYKHSIAENSQYGVAVCTVVAED 982 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 22.6 bits (46), Expect = 9.7 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = -3 Query: 407 AIPCVPWVILG 375 A+ C+PW++LG Sbjct: 649 ALLCIPWMLLG 659 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 621,011 Number of Sequences: 2352 Number of extensions: 11752 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -