BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_P24 (589 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 2.2 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 2.2 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 2.2 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 2.2 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 3.9 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 3.9 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 5.1 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 22 5.1 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 22 5.1 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 22 5.1 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 22 5.1 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 22 5.1 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 22 5.1 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 22 5.1 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 22 5.1 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 22 5.1 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 22 5.1 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 5.1 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 5.1 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 5.1 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 5.1 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 5.1 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 5.1 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 5.1 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 6.8 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 6.8 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 197 RSASIKKRKEIFKRAEQYVKEYRIKER 277 RS S + +E K+ QY K Y KE+ Sbjct: 2 RSCSRDRNREYRKKDRQYEKLYNEKEK 28 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 197 RSASIKKRKEIFKRAEQYVKEYRIKER 277 RS S + +E K+ QY K Y KE+ Sbjct: 2 RSCSRDRNREYRKKDRQYEKLYNEKEK 28 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 197 RSASIKKRKEIFKRAEQYVKEYRIKER 277 RS S + +E K+ QY K Y KE+ Sbjct: 2 RSCSRDRNREYRKKDRQYEKLYNEKEK 28 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 197 RSASIKKRKEIFKRAEQYVKEYRIKER 277 RS S + +E K+ QY K Y KE+ Sbjct: 2 RSCSRDRNREYRKKDRQYEKLYNEKEK 28 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 3.9 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 185 HSIMRSASIKKRKEIFKRAEQYVKEYRIKERD-EIRLARQARNR 313 +S RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 231 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 274 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 3.9 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 185 HSIMRSASIKKRKEIFKRAEQYVKEYRIKERD-EIRLARQARNR 313 +S RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 231 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 274 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.8 bits (44), Expect = 5.1 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +3 Query: 366 VVSTKYHPRYARYCSCSGCVRSTTACSFVSTR 461 V+S KY + C CS S T S R Sbjct: 318 VMSAKYRNAFKETCRCSPSNPSITRTGLSSVR 349 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.1 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 197 RSASIKKRKEIFKRAEQYVKEYRIKERD-EIRLARQARNR 313 RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 5.1 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 197 RSASIKKRKEIFKRAEQYVKEYRIKERD-EIRLARQARNR 313 RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.1 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 197 RSASIKKRKEIFKRAEQYVKEYRIKERD-EIRLARQARNR 313 RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.1 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 197 RSASIKKRKEIFKRAEQYVKEYRIKERD-EIRLARQARNR 313 RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.1 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 197 RSASIKKRKEIFKRAEQYVKEYRIKERD-EIRLARQARNR 313 RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.1 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 197 RSASIKKRKEIFKRAEQYVKEYRIKERD-EIRLARQARNR 313 RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.1 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 197 RSASIKKRKEIFKRAEQYVKEYRIKERD-EIRLARQARNR 313 RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.1 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 197 RSASIKKRKEIFKRAEQYVKEYRIKERD-EIRLARQARNR 313 RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.1 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 197 RSASIKKRKEIFKRAEQYVKEYRIKERD-EIRLARQARNR 313 RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.1 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 197 RSASIKKRKEIFKRAEQYVKEYRIKERD-EIRLARQARNR 313 RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 41 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 5.1 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 185 HSIMRSASIKKRKEIFKRAEQYVKEYRIKER-DEIRLARQARNR 313 +S RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 220 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 263 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 5.1 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 185 HSIMRSASIKKRKEIFKRAEQYVKEYRIKER-DEIRLARQARNR 313 +S RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 231 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 274 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.8 bits (44), Expect = 5.1 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 185 HSIMRSASIKKRKEIFKRAEQYVKEYRIKER-DEIRLARQARNR 313 +S RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 220 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 263 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 5.1 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 185 HSIMRSASIKKRKEIFKRAEQYVKEYRIKER-DEIRLARQARNR 313 +S RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 231 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 274 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 5.1 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 185 HSIMRSASIKKRKEIFKRAEQYVKEYRIKER-DEIRLARQARNR 313 +S RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 231 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 274 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.8 bits (44), Expect = 5.1 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 185 HSIMRSASIKKRKEIFKRAEQYVKEYRIKER-DEIRLARQARNR 313 +S RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 220 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 263 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 5.1 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 185 HSIMRSASIKKRKEIFKRAEQYVKEYRIKER-DEIRLARQARNR 313 +S RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 220 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 263 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 6.8 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 197 RSASIKKRKEIFKRAEQYVKEYRIKER-DEIRLARQARNR 313 RS S + +E K+ QY K + KE+ E R +R+ +R Sbjct: 2 RSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 41 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 6.8 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 185 HSIMRSASIKKRKEIFKRAEQYVKEYRIKER 277 +S RS S + +E K+ QY K + KE+ Sbjct: 231 YSRERSCSRDRNREYRKKDRQYEKLHNEKEK 261 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,201 Number of Sequences: 438 Number of extensions: 3798 Number of successful extensions: 27 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17115420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -