BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_P22 (404 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22013| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.54) 29 1.9 SB_53875| Best HMM Match : Glu_synthase (HMM E-Value=0) 27 5.8 >SB_22013| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.54) Length = 341 Score = 28.7 bits (61), Expect = 1.9 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 74 ISVAAAARVILNILIDLVLGIIFCFEFNFILKLRMVRIF 190 I RVI+N + +++G++ CF I K+R +F Sbjct: 140 IEALVITRVIINQTLFVLVGMVLCFAVRKITKIRTSNLF 178 >SB_53875| Best HMM Match : Glu_synthase (HMM E-Value=0) Length = 911 Score = 27.1 bits (57), Expect = 5.8 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -1 Query: 290 KVVSQTNV--LTSKITKT*IHLRPRPRPGHSN 201 K+VS+ V + S +TK+ +++ P PR HSN Sbjct: 528 KLVSEVGVGVIASGVTKSNVYVVPGPRGAHSN 559 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,984,229 Number of Sequences: 59808 Number of extensions: 168511 Number of successful extensions: 295 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 295 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 727815563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -