BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_P15 (274 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 2.0 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 22 3.6 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.0 bits (47), Expect = 2.0 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +3 Query: 162 AIETSDQKPHETDLAAKERKMSTSDPFLTSSRISSP 269 A+ + Q+P T LAA + P + SS +++P Sbjct: 67 AVSSQLQRPQPTVLAASPAPQPSLAPVVPSSVVTAP 102 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 22.2 bits (45), Expect = 3.6 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +3 Query: 48 QETSLSETNSTYNEQTTSSVAKSNVATEITSQTELSSLAIETSDQKPHETDLA 206 Q+ L +T + EQTTSS +N T T + A+E S H+ +A Sbjct: 569 QQQQLQQTLAEPKEQTTSSSPSNNRLTP-PKGTFFYASAVENS-LTAHQASIA 619 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 225,319 Number of Sequences: 2352 Number of extensions: 2955 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 563,979 effective HSP length: 54 effective length of database: 436,971 effective search space used: 15730956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -