BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_P13 (384 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146752-1|AAO12067.1| 277|Anopheles gambiae odorant-binding pr... 23 2.9 AY146751-1|AAO12066.1| 277|Anopheles gambiae odorant-binding pr... 23 2.9 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 5.1 AY752899-1|AAV30073.1| 43|Anopheles gambiae peroxidase 5B prot... 22 6.7 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 22 6.7 >AY146752-1|AAO12067.1| 277|Anopheles gambiae odorant-binding protein AgamOBP35 protein. Length = 277 Score = 23.4 bits (48), Expect = 2.9 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -1 Query: 99 FTFFANFSSWISIGPLKHNL 40 F + F +W PL HNL Sbjct: 191 FAYVTRFGAWSKDAPLLHNL 210 >AY146751-1|AAO12066.1| 277|Anopheles gambiae odorant-binding protein AgamOBP36 protein. Length = 277 Score = 23.4 bits (48), Expect = 2.9 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -1 Query: 99 FTFFANFSSWISIGPLKHNL 40 F + F +W PL HNL Sbjct: 191 FAYVTRFGAWSKDAPLLHNL 210 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 22.6 bits (46), Expect = 5.1 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = -3 Query: 265 AVVNLTNLCARRIYAESCNVKIYVVATSVNTQDYLVFDYV 146 AV++ N+ I++ C +KI+ + + + +FD+V Sbjct: 1653 AVLDYLNMIFICIFSSECLMKIFALRYHYFIEPWNLFDFV 1692 >AY752899-1|AAV30073.1| 43|Anopheles gambiae peroxidase 5B protein. Length = 43 Score = 22.2 bits (45), Expect = 6.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 2 HEARPKEHNALSLRLCLRGPI 64 H A +EHN L+ +LC P+ Sbjct: 7 HVAFLREHNRLAQQLCKARPL 27 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 22.2 bits (45), Expect = 6.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 20 EHNALSLRLCLRGP 61 +H AL++RLCL P Sbjct: 225 DHKALTVRLCLPTP 238 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 428,862 Number of Sequences: 2352 Number of extensions: 8928 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29501847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -