BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_P13 (384 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11720.1 68414.m01345 starch synthase, putative strong simila... 29 1.4 At2g22530.1 68415.m02672 phosphatidylinositolglycan-related simi... 27 3.3 At4g33890.2 68417.m04809 expressed protein 27 4.3 At4g33890.1 68417.m04808 expressed protein 27 4.3 At3g49190.1 68416.m05376 condensation domain-containing protein ... 27 4.3 At5g48130.1 68418.m05945 phototropic-responsive NPH3 family prot... 26 7.5 At1g03060.1 68414.m00280 WD-40 repeat family protein / beige-rel... 26 7.5 At5g14530.1 68418.m01703 transducin family protein / WD-40 repea... 26 9.9 At4g15475.1 68417.m02365 F-box family protein (FBL4) 99.7% ident... 26 9.9 At2g30240.1 68415.m03680 cation/hydrogen exchanger, putative (CH... 26 9.9 >At1g11720.1 68414.m01345 starch synthase, putative strong similarity to soluble-starch-synthase [Solanum tuberosum] GI:1911166 Length = 1025 Score = 28.7 bits (61), Expect = 1.4 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 220 LHKFVLHKDWLNSRLHI--FTTRSFFFFVGGKSIY 318 L K +H+DWL+ LHI + F F G+S+Y Sbjct: 174 LEKTWIHEDWLSCLLHIPKEAYKMDFVFFNGQSVY 208 >At2g22530.1 68415.m02672 phosphatidylinositolglycan-related similar to Pig-o [Mus musculus] GI:8099973 Length = 897 Score = 27.5 bits (58), Expect = 3.3 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +1 Query: 34 IFKVMFKRSYRYPTAEVCKESEVLTVWQIFILKVCI 141 +F +FK Y P VC S +L + ++FI + + Sbjct: 490 VFLSLFKEVYHEPKDRVCSLSNLLNLEEVFIFALLL 525 >At4g33890.2 68417.m04809 expressed protein Length = 342 Score = 27.1 bits (57), Expect = 4.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -2 Query: 326 GIA*MLFPPTKKKKDRVVNMCSREFNQSLCKTN 228 G++ L +K V+MCSR FN+ C+ N Sbjct: 199 GVSMSLRNGATRKSVSNVSMCSRSFNRETCQNN 231 >At4g33890.1 68417.m04808 expressed protein Length = 342 Score = 27.1 bits (57), Expect = 4.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -2 Query: 326 GIA*MLFPPTKKKKDRVVNMCSREFNQSLCKTN 228 G++ L +K V+MCSR FN+ C+ N Sbjct: 199 GVSMSLRNGATRKSVSNVSMCSRSFNRETCQNN 231 >At3g49190.1 68416.m05376 condensation domain-containing protein contains Pfam profile PF00668: Condensation domain Length = 522 Score = 27.1 bits (57), Expect = 4.3 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 140 LVNIIKY*IVLGIHRCCNDVYFDVTTLCINSSCTKI 247 LV +I ++LG++ C+ + F VTTL + + T I Sbjct: 203 LVKVIWTAVILGLNTVCDALEFIVTTLFVKDTETPI 238 >At5g48130.1 68418.m05945 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 625 Score = 26.2 bits (55), Expect = 7.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 141 NTHFKYKDLPDSKNFTFFANFS 76 NTH +KD DS FT A+FS Sbjct: 469 NTHQAFKDCSDSFRFTNSADFS 490 >At1g03060.1 68414.m00280 WD-40 repeat family protein / beige-related similar to BEIGE (GI:3928547) [Rattus norvegicus]; Similar to gb|U70015 lysosomal trafficking regulator from Mus musculus and contains 2 Pfam PF00400 WD-40, G-beta repeats. ESTs gb|T43386 and gb|AA395236 come from this gene Length = 3601 Score = 26.2 bits (55), Expect = 7.5 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = -2 Query: 137 HTLSIKICQTVRTSLSLQTSAVGYL*DLLNITLKIKRCALSVL 9 H + ++CQ +RT L + G+ L +I LKI A++V+ Sbjct: 527 HVENYRLCQELRTVPLLVLNMAGFPSSLQDIILKILEYAVTVV 569 >At5g14530.1 68418.m01703 transducin family protein / WD-40 repeat family protein similar to Will die slowly protein (SP:Q9V3J8) [Drosophila melanogaster] ; contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 1 weak) Length = 330 Score = 25.8 bits (54), Expect = 9.9 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -2 Query: 296 KKKKDRVVNMCSREFNQSLCKTNLCREL*RQNIRRCNICE 177 K KDRVV++C N S +L R + ++ R N C+ Sbjct: 111 KGHKDRVVSLCMSPINDSFMSGSLDRSVRLWDL-RVNACQ 149 >At4g15475.1 68417.m02365 F-box family protein (FBL4) 99.7% identical to F-box protein family, AtFBL4 (GP:21536497) [Arabidopsis thaliana]; similar to grr1 GI:2407790 from [Glycine max] Length = 610 Score = 25.8 bits (54), Expect = 9.9 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 224 CREL*RQNIRRCNICEYPGLFSI*L-CLLIHTLSIKICQTV 105 CR L + +IRRC G+ SI C + LS++ C V Sbjct: 423 CRNLKKLHIRRCYEIGNKGIISIGKHCKSLTELSLRFCDKV 463 >At2g30240.1 68415.m03680 cation/hydrogen exchanger, putative (CHX13) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 831 Score = 25.8 bits (54), Expect = 9.9 Identities = 21/84 (25%), Positives = 36/84 (42%) Frame = +1 Query: 28 RFIFKVMFKRSYRYPTAEVCKESEVLTVWQIFILKVCISKHNQILNSPGYSQMLQRRIF* 207 RF+ ++ S RY + K + + T L++ + +N + N P +L+ Sbjct: 443 RFLVVYLYDPSKRYKSKS--KRTILNTRQHNLQLRLLLGLYN-VENVPSMVNLLEATYPT 499 Query: 208 RYNSLHKFVLHKDWLNSRLHIFTT 279 R+N + F LH L R H T Sbjct: 500 RFNPISFFTLHLVELKGRAHALLT 523 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,470,903 Number of Sequences: 28952 Number of extensions: 164794 Number of successful extensions: 377 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 377 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 537681456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -