BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_P12 (395 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.42 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.42 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 6.8 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 20 9.0 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.6 bits (51), Expect = 0.42 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 265 TWSTSTVKAAASTQKTL-ERGRSSISACTLTLVPSTRDSEITSI 393 T STS+ + S QK+L RGRSS S+ TL+P +E T + Sbjct: 1822 TSSTSSDISPMSEQKSLPRRGRSSRSSLR-TLLPPISVAETTFV 1864 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.6 bits (51), Expect = 0.42 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 265 TWSTSTVKAAASTQKTL-ERGRSSISACTLTLVPSTRDSEITSI 393 T STS+ + S QK+L RGRSS S+ TL+P +E T + Sbjct: 1818 TSSTSSDISPMSEQKSLPRRGRSSRSSLR-TLLPPISVAETTFV 1860 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.6 bits (41), Expect = 6.8 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +3 Query: 303 PEDARARALVDQ 338 PE R++AL+DQ Sbjct: 1320 PESMRSKALIDQ 1331 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 20.2 bits (40), Expect = 9.0 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -1 Query: 56 NRHYFAFL 33 NRHY+AF+ Sbjct: 472 NRHYYAFV 479 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,618 Number of Sequences: 438 Number of extensions: 1517 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9761793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -