Samia BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0001_P03
         (487 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC006656-1|AAF39881.1|  592|Caenorhabditis elegans Hypothetical ...    28   3.1  

>AC006656-1|AAF39881.1|  592|Caenorhabditis elegans Hypothetical
           protein H12I13.1 protein.
          Length = 592

 Score = 28.3 bits (60), Expect = 3.1
 Identities = 21/64 (32%), Positives = 31/64 (48%)
 Frame = -1

Query: 436 VMSLKIFQSSTIWIINDIHICN*KVEE*KIKALYGFYETRMQVKLHSLFILVTIKYFKTY 257
           VMSLK+ + S   +  DIH+ N  V   K   L   Y    +VKL+S  +++ +  F   
Sbjct: 531 VMSLKVVKDSINMVHRDIHLWNVLVSRTKTTCL--DYSMDGKVKLNSYGVVMHLIDFSKS 588

Query: 256 KYRG 245
            Y G
Sbjct: 589 LYGG 592


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,008,164
Number of Sequences: 27780
Number of extensions: 191063
Number of successful extensions: 457
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 441
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 457
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 903458030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)