BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_P02 (444 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 25 0.49 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 8.0 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 24.6 bits (51), Expect = 0.49 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -2 Query: 404 NFILLKHFTGDVKG*IFTVDYTPDEVQVFWDKVFTVVHDK 285 NF++ H T + K + ++ +T DE+ WD +V D+ Sbjct: 166 NFLIYPHDTQECKLQMESLSHTTDEMIFQWDPDVPLVVDE 205 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 20.6 bits (41), Expect = 8.0 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -1 Query: 222 EPCEVQRVKHGIPTDLLRRSVLQQDDP 142 +PC+ ++ G+P + QQD P Sbjct: 50 DPCDPSLLRQGVPGHHYGAAGSQQDMP 76 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,205 Number of Sequences: 438 Number of extensions: 2556 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11574126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -