BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_P01 (221 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0253 - 6319198-6319240,6319364-6319552,6319650-6319995,632... 25 8.3 >09_02_0253 - 6319198-6319240,6319364-6319552,6319650-6319995, 6320811-6320893,6320977-6321074,6321384-6321461, 6321891-6322000,6322083-6322180,6323199-6323296, 6323403-6323463,6323688-6323831,6324103-6324206, 6324634-6324787,6324860-6324879,6324967-6325029, 6326521-6326632,6326711-6326796,6326872-6326899, 6327242-6327293,6329034-6329250 Length = 727 Score = 25.0 bits (52), Expect = 8.3 Identities = 17/57 (29%), Positives = 27/57 (47%) Frame = -2 Query: 202 LYRYATPMKSTASACDNNSKCCVDILYRYIDIKTVDCIFLRNRINYLLKMILFKSTF 32 LYR + ++S A+A +N L ++ + CI +N +NY FK TF Sbjct: 191 LYRTMSLVRSQAAAGENFFMMVFQFLETFVGSLSSGCITAQNILNY------FKGTF 241 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,650,337 Number of Sequences: 37544 Number of extensions: 44135 Number of successful extensions: 97 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 14,793,348 effective HSP length: 53 effective length of database: 12,803,516 effective search space used: 256070320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -