BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_P01 (221 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol p... 27 2.2 At2g42920.1 68415.m05318 pentatricopeptide (PPR) repeat-containi... 25 5.1 At3g61170.1 68416.m06846 pentatricopeptide (PPR) repeat-containi... 25 9.0 At1g76350.1 68414.m08871 RWP-RK domain-containing protein simila... 25 9.0 >At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol protease, putative similar to cysteine proteinase RD21A precursor (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 463 Score = 26.6 bits (56), Expect = 2.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 169 ASACDNNSKCCVDILYRYIDIKTVDCIFLRN 77 A+ CD+NS CC Y D+ C+ +N Sbjct: 409 ATCCDDNSSCCPH-EYPVCDVNRGTCLMSKN 438 >At2g42920.1 68415.m05318 pentatricopeptide (PPR) repeat-containing protein and genefinder Length = 559 Score = 25.4 bits (53), Expect = 5.1 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +1 Query: 109 CRYIDTKYR-HSILSCYRTH*RLISLASRIDIINY 210 C I+ + H +SC TH + + S +DI+N+ Sbjct: 498 CSSIEVDFEVHEFISCGGTHPKSAEIYSLLDILNW 532 >At3g61170.1 68416.m06846 pentatricopeptide (PPR) repeat-containing protein strong similarity to PCMP-H2 [Arabidopsis thaliana] GI:5050911; contains Pfam profile PF01535: PPR repeat Length = 783 Score = 24.6 bits (51), Expect = 9.0 Identities = 10/31 (32%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +1 Query: 109 CRYIDTKYR-HSILSCYRTH*RLISLASRID 198 C +++ K + HS +S R H R++ + S++D Sbjct: 635 CSWVEEKGKVHSFMSEDRRHPRMVEIYSKVD 665 >At1g76350.1 68414.m08871 RWP-RK domain-containing protein similar to nodule inception protein [Lotus japonicus] GI:6448579; contains Pfam profile: PF02042 RWP-RK domain Length = 808 Score = 24.6 bits (51), Expect = 9.0 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 199 YRYATPMKSTASACDNNSKC 140 Y ++ P KS S+C ++S C Sbjct: 652 YSHSPPAKSPGSSCSHSSSC 671 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,123,202 Number of Sequences: 28952 Number of extensions: 39929 Number of successful extensions: 91 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 12,070,560 effective HSP length: 53 effective length of database: 10,536,104 effective search space used: 210722080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -