BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O23 (540 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 48 2e-07 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 27 0.30 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 27 0.30 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 27 0.30 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 27 0.30 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 27 0.30 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 27 0.30 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 27 0.30 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 27 0.30 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 27 0.30 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 27 0.30 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 27 0.30 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 27 0.30 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 27 0.30 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 27 0.30 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 27 0.30 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 27 0.30 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 27 0.30 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 27 0.30 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 27 0.30 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 27 0.30 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 27 0.30 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 27 0.30 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 27 0.30 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 27 0.30 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 27 0.30 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 27 0.30 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 27 0.30 AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection... 25 2.1 AY331408-1|AAQ97589.1| 100|Anopheles gambiae agCP14332 protein. 24 2.8 AY331404-1|AAQ97585.1| 100|Anopheles gambiae agCP14332 protein. 24 2.8 AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 24 3.7 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 5.0 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 5.0 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 23 5.0 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 23 5.0 AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. 23 6.5 AY331407-1|AAQ97588.1| 101|Anopheles gambiae agCP14332 protein. 23 8.7 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 48.0 bits (109), Expect = 2e-07 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 1/73 (1%) Frame = +3 Query: 156 ELVTDSDRDALVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDV 335 +L D+ +V+F+A WCG C+ + P EE K D+ V +VK+D + +QY++ Sbjct: 14 KLEAAGDQLVVVDFFATWCGPCKVIAPKLEEFQNKYADKIV-VVKVDVDECEELAAQYNI 72 Query: 336 SGFPT-IYWKPKD 371 + PT ++ K K+ Sbjct: 73 ASMPTFLFIKRKE 85 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 150 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 150 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 150 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 150 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 150 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 150 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 80 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 135 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 80 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 135 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 82 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 137 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 82 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 137 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 85 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 140 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 85 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 140 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 150 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 150 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 150 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 150 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 150 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 150 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 97 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 152 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 97 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 152 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 79 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 134 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 79 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 134 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/56 (21%), Positives = 25/56 (44%) Frame = +3 Query: 186 LVEFYAPWCGHCQKLTPIWEELGEKLKDEDVDIVKIDATANDWPKSQYDVSGFPTI 353 ++ FYA WC C K +++L + L+ + ++A + + V P + Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLEPYGITFATVNAGHEEQLVRKVGVHSLPCV 149 >AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection responsive shortpeptide protein. Length = 81 Score = 24.6 bits (51), Expect = 2.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 159 LVTDSDRDALVEFYAPWCGHCQKL 230 L T + DA+V YAP C C+ + Sbjct: 12 LCTAAVADAMVFAYAPTCARCKSI 35 >AY331408-1|AAQ97589.1| 100|Anopheles gambiae agCP14332 protein. Length = 100 Score = 24.2 bits (50), Expect = 2.8 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = +1 Query: 316 RNLSTTCLVSQPSTGNLRTAPRNQSDTMVVAL*KTSSNTYLNKPVANSRAGTERAMPRRQ 495 R+L TT + P T RTAP DT+ + + S+ + V N A RR+ Sbjct: 2 RSLHTT---TTPCTRRNRTAPARNYDTIPIDRWRVSNRMKEGRNVENGAANLTPGNVRRR 58 Query: 496 MK 501 + Sbjct: 59 TR 60 >AY331404-1|AAQ97585.1| 100|Anopheles gambiae agCP14332 protein. Length = 100 Score = 24.2 bits (50), Expect = 2.8 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = +1 Query: 316 RNLSTTCLVSQPSTGNLRTAPRNQSDTMVVAL*KTSSNTYLNKPVANSRAGTERAMPRRQ 495 R+L TT + P T RTAP DT+ + + S+ + V N A RR+ Sbjct: 2 RSLHTT---TTPCTRRNRTAPARNYDTIPIDRWRVSNRMKEGRNVENGAANLTPGNVRRR 58 Query: 496 MK 501 + Sbjct: 59 TR 60 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 23.8 bits (49), Expect = 3.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 528 SFIFTDITILHLSSWHCP 475 SF+ + IL+L W CP Sbjct: 108 SFLVPTLAILNLPQWKCP 125 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 5.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 292 STRQPTTGRNLSTTCLVSQPSTGNL 366 ST + R +STTC S PST +L Sbjct: 346 STVENKKKRKMSTTCDNSSPSTPSL 370 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.4 bits (48), Expect = 5.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 292 STRQPTTGRNLSTTCLVSQPSTGNL 366 ST + R +STTC S PST +L Sbjct: 346 STVENKKKRKMSTTCDNSSPSTPSL 370 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 23.4 bits (48), Expect = 5.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 292 STRQPTTGRNLSTTCLVSQPSTGNL 366 ST + R +STTC S PST +L Sbjct: 298 STVENKKKRKMSTTCDNSSPSTPSL 322 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.4 bits (48), Expect = 5.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 292 STRQPTTGRNLSTTCLVSQPSTGNL 366 ST + R +STTC S PST +L Sbjct: 306 STVENKKKRKMSTTCDNSSPSTPSL 330 >AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. Length = 401 Score = 23.0 bits (47), Expect = 6.5 Identities = 20/56 (35%), Positives = 29/56 (51%) Frame = +3 Query: 15 KSEFSIENLVAFAKDLIGGKLEPFVKSEAVPESNDGPVKVAVGKNFKELVTDSDRD 182 K +F+ L AK+L K E FVKS + + +D VAV + F D++RD Sbjct: 338 KHDFA-PRLTRVAKEL--DKCESFVKSGSKTQQSDLEKLVAVKRMF--ATRDANRD 388 >AY331407-1|AAQ97588.1| 101|Anopheles gambiae agCP14332 protein. Length = 101 Score = 22.6 bits (46), Expect = 8.7 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = +1 Query: 316 RNLSTTCLVSQPSTGNLRTAPRNQSDTMVVAL*KTSSNTYLNKPVANSRAGTERAMPRRQ 495 R+L TT + P T RTAP DT+ + + + + V N A RR+ Sbjct: 2 RSLHTT---TTPCTRRNRTAPARNYDTIPIDRWRVGNRMKEGRNVKNGAANLTPGNVRRR 58 Query: 496 MK 501 + Sbjct: 59 TR 60 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 539,836 Number of Sequences: 2352 Number of extensions: 10009 Number of successful extensions: 85 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -