BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O22 (569 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 25 0.60 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 21 7.4 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 24.6 bits (51), Expect = 0.60 Identities = 18/65 (27%), Positives = 29/65 (44%) Frame = -3 Query: 522 VSVWLQILKLQGRKSADIRKYSTLKTIVFYYEKLKIIIADLHPLXXXXXXXX*PLSYRDF 343 +S+ Q+ L SA+ +T+ +FY KL +I+ LH L SY+ Sbjct: 71 LSIVTQLADLIFSASANASGVATVFFCLFYQNKLIEVISKLHKLDNKLKHMLIWKSYKRT 130 Query: 342 SLSIT 328 + IT Sbjct: 131 QIFIT 135 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.0 bits (42), Expect = 7.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 500 KICSQTLTGVSRQY*EPVP 556 K QTL G S + EPVP Sbjct: 376 KAIHQTLGGSSNEIVEPVP 394 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,867 Number of Sequences: 336 Number of extensions: 2842 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14099535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -