BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O22 (569 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53270| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_54952| Best HMM Match : 7tm_1 (HMM E-Value=7.2e-16) 27 8.2 >SB_53270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 124 AVVYVILSITCF*ILYRLSALTTI 53 A +YV +SI C I Y+L +L TI Sbjct: 201 AAIYVSISIVCALIFYKLRSLETI 224 >SB_54952| Best HMM Match : 7tm_1 (HMM E-Value=7.2e-16) Length = 357 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +1 Query: 154 YKAHYVTKYIILVFLCTHIYVTYVXXXXXXXXXXSLTNRDQDQSLTTG 297 YK Y+ +ILVF C +++ T+V T D+ + T G Sbjct: 242 YKLSYMAASVILVFFCPYLF-TFVYTSLIVGNFIDTTIADEYTNRTVG 288 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,428,548 Number of Sequences: 59808 Number of extensions: 331247 Number of successful extensions: 656 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -