BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O21 (438 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 26 0.14 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 25 0.32 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 26.2 bits (55), Expect = 0.14 Identities = 14/56 (25%), Positives = 27/56 (48%) Frame = +2 Query: 101 LKLRCTLERDVWSDHTFRACLARFYSVMFSSCNLIQYFAIFDYLLCNFGGVLRHIV 268 L ++C + ++ +F A L +FY +S+ F + D+ LC +L H + Sbjct: 46 LLIQCYIAVSIFGSSSFEADLRQFYKTAYSA-----IFTVIDFSLCK--AILVHAI 94 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 25.0 bits (52), Expect = 0.32 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -2 Query: 317 SLRVIIYT*LHLCIIITLYDVKRH--QNYIINS 225 SLR +YT +H+ III LY + +N+I S Sbjct: 22 SLRFKLYTIVHIFIIIALYAHSSYGRENFIYGS 54 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,606 Number of Sequences: 336 Number of extensions: 2073 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9775509 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -