BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O21 (438 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23529-3|AAY86217.1| 246|Caenorhabditis elegans Hypothetical pr... 27 4.5 Z83744-4|CAB06040.4| 735|Caenorhabditis elegans Hypothetical pr... 27 6.0 >U23529-3|AAY86217.1| 246|Caenorhabditis elegans Hypothetical protein C15B12.9 protein. Length = 246 Score = 27.5 bits (58), Expect = 4.5 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -1 Query: 129 SRSRVHRSFNFQHVQLSRSLFMIHYIKF-VGGHRAFPT 19 S ++ R+F+ Q L LF+ H I+F + GH F T Sbjct: 206 SPDQIDRNFSIQLEMLRNKLFVDHVIRFDILGHNPFNT 243 >Z83744-4|CAB06040.4| 735|Caenorhabditis elegans Hypothetical protein C06A12.4 protein. Length = 735 Score = 27.1 bits (57), Expect = 6.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -1 Query: 357 VDHSAKSASQFRILAPCHYLHLTTLVYHNY 268 +D + KSA IL YLHL+ + YH + Sbjct: 277 MDETFKSAFMRDILKGLQYLHLSPVAYHGH 306 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,729,929 Number of Sequences: 27780 Number of extensions: 180799 Number of successful extensions: 461 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 461 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 745968860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -